EGF (Epidermal Growth Factor)

1. Overview

Epidermal Growth Factor (EGF) is a 53-amino-acid polypeptide with a molecular weight of 6,045 Da, first isolated by Stanley Cohen in 1962 from mouse submaxillary gland extracts [1]. Cohen observed that injection of the gland extract into newborn mice caused precocious eyelid opening and premature tooth eruption -- effects attributable to the stimulation of epidermal cell proliferation. This discovery, along with Rita Levi-Montalcini's work on nerve growth factor (NGF), was recognized with the Nobel Prize in Physiology or Medicine in 1986 [2][24]. EGF and NGF were the first growth factors to be isolated and characterized, opening a vast field of research into growth-regulating signal substances.

Human EGF is synthesized as a large 1,207-amino-acid type I transmembrane precursor protein called prepro-EGF [18]. The mature 53-residue EGF peptide (positions 970-1023 of the precursor) is released from the cell surface by proteolytic cleavage. The precursor itself contains nine EGF-like domains and nine low-density lipoprotein receptor (LDLR) class B repeats. Remarkably, the membrane-bound precursor is biologically active and can bind the EGF receptor on adjacent cells, a form of signaling known as juxtacrine stimulation [18].

EGF was independently discovered in human urine under the name "urogastrone" due to its ability to inhibit gastric acid secretion, and the two molecules were later confirmed to be identical [3]. EGF is produced by salivary glands, Brunner's glands of the duodenum, the kidney, and other tissues, and is found in saliva, urine, milk, plasma, and amniotic fluid. Its primary physiological roles include maintenance and repair of epithelial tissues throughout the body.

Molecular Weight

6,045 Da (6.0 kDa)

Amino Acids

53 residues (mature form); derived from 1,207-aa precursor (prepro-EGF)

Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Disulfide Bonds

3 intramolecular (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42)

Receptor

EGFR (ErbB1/HER1) -- receptor tyrosine kinase

Half-life

Approximately 1-2 minutes (plasma); rapidly cleared by receptor-mediated endocytosis

Gene

EGF (chromosome 4q25); UniProt P01133

Key Clinical Product

Heberprot-P (intralesional rhEGF for diabetic foot ulcers; approved in Cuba and 15+ countries)

FDA Status

Not FDA-approved as a standalone drug; rhEGF used in some wound care formulations

2. Molecular Structure

Mature human EGF consists of 53 amino acid residues with the sequence:

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

The molecule has a molecular weight of 6,045 Da and is stabilized by three intramolecular disulfide bonds connecting six conserved cysteine residues [3]:

• Cys6-Cys20 (A-loop): Forms the N-terminal loop; essential for biological activity and high-affinity EGFR binding
• Cys14-Cys31 (B-loop): Creates the central structural loop
• Cys33-Cys42 (C-loop): Establishes the C-terminal loop

These three disulfide bridges generate a compact tertiary structure consisting of three distinct loops (A, B, and C) that are critical for receptor binding. Disruption of any disulfide bond, particularly the A-loop (Cys6-Cys20), significantly reduces or eliminates biological activity [3].

The three-dimensional structure, determined by NMR and X-ray crystallography, reveals that EGF adopts a fold characterized by a short antiparallel beta-sheet and minimal alpha-helical content. This structural motif is known as the EGF domain (or EGF-like domain), one of the most common protein domains in nature. The EGF domain is found in hundreds of extracellular proteins across species, including coagulation factors, the Notch receptor family, fibrillin, and many others [13].

EGF is not glycosylated in its mature form, which has facilitated its production as recombinant human EGF (rhEGF) in bacterial expression systems such as Escherichia coli and in barley-based plant expression platforms used by some cosmetic manufacturers.

3. Mechanism of Action

Receptor Binding and Activation

EGF exerts its biological effects by binding to the Epidermal Growth Factor Receptor (EGFR), also designated ErbB1 or HER1, a 170-kDa transmembrane receptor tyrosine kinase [4]. EGFR is a member of the ErbB family of receptors, which includes four members: EGFR (ErbB1), HER2/ErbB2, HER3/ErbB3, and HER4/ErbB4.

The binding mechanism proceeds through the following steps [4][5]:

1. Ligand binding: EGF binds to the extracellular domain of EGFR, inducing a conformational change that exposes a dimerization arm in domain II of the receptor
2. Receptor dimerization: The exposed dimerization arm enables formation of receptor dimers -- either homodimers (EGFR-EGFR) or heterodimers (EGFR-ErbB2, EGFR-ErbB3, or EGFR-ErbB4). HER2 is the preferred dimerization partner
3. Trans-autophosphorylation: Dimerization activates the intracellular tyrosine kinase domains, which phosphorylate each other in trans at specific tyrosine residues in the C-terminal tail
4. Adaptor protein recruitment: Phosphorylated tyrosine residues serve as docking sites for signaling proteins containing SH2 (Src homology 2) and PTB (phosphotyrosine binding) domains

Downstream Signaling Pathways

EGFR activation triggers multiple intracellular signaling cascades [4][5][20]:

Ras-MAPK/ERK Pathway: Phosphorylated EGFR recruits the adaptor protein Grb2 (directly or via Shc), which binds the guanine nucleotide exchange factor SOS (Son of Sevenless). SOS activates Ras by catalyzing the exchange of GDP for GTP. Activated Ras-GTP triggers the kinase cascade Raf-1 to MEK1/2 to ERK1/2. Nuclear ERK phosphorylates transcription factors (Elk-1, c-Myc, c-Fos) that drive gene expression programs for cell proliferation, differentiation, and survival. This is the principal mitogenic pathway downstream of EGFR.

PI3K-Akt/PKB Pathway: EGFR activates phosphatidylinositol 3-kinase (PI3K), a heterodimer of regulatory (p85) and catalytic (p110) subunits, either directly or through Ras. PI3K generates the lipid second messenger PIP3 (phosphatidylinositol 3,4,5-trisphosphate), which recruits and activates Akt (protein kinase B). Akt promotes cell survival by phosphorylating and inactivating pro-apoptotic proteins (Bad, caspase-9), activating mTOR for protein synthesis, and stimulating cell cycle progression.

PLCgamma Pathway: Phospholipase C-gamma (PLCgamma) binds directly to phosphorylated EGFR and hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP2) into two second messengers: inositol 1,4,5-trisphosphate (IP3), which triggers calcium release from the endoplasmic reticulum, and diacylglycerol (DAG), which activates protein kinase C (PKC). This pathway regulates cell motility, cytoskeletal reorganization, and gene expression.

JAK-STAT Pathway: EGFR can activate Signal Transducers and Activators of Transcription (STAT) proteins, particularly STAT3 and STAT5, which dimerize and translocate to the nucleus to regulate genes involved in proliferation, survival, and immune modulation.

Signal Termination

EGFR signaling is tightly regulated through receptor-mediated endocytosis: ligand-bound receptors are internalized via clathrin-coated pits, sorted in endosomes, and either recycled to the cell surface or targeted for lysosomal degradation. This internalization and degradation process accounts for EGF's short plasma half-life of approximately 1-2 minutes [4].

4. Pharmacokinetics

Systemic Pharmacokinetics

EGF's pharmacokinetic profile is dominated by rapid receptor-mediated clearance and enzymatic degradation [4][9][19]:

• Plasma half-life: 1-2 minutes following intravenous administration, among the shortest of any peptide growth factor. This ultra-short half-life reflects avid receptor-mediated internalization by EGFR-expressing cells throughout the body (liver, kidneys, skin, GI tract) rather than renal filtration alone
• Volume of distribution: Approximately 2-3 L in adults, consistent with distribution primarily in the vascular and interstitial compartments
• Clearance mechanism: EGF is cleared predominantly by receptor-mediated endocytosis. Upon binding EGFR on hepatocytes and other cells, the ligand-receptor complex is internalized via clathrin-coated pits within 2-5 minutes. Internalized complexes traffic to early endosomes, where low pH promotes EGF dissociation. EGF is subsequently sorted to lysosomes for proteolytic degradation, while EGFR may be recycled to the cell surface (at low EGF concentrations) or co-degraded (at high concentrations) [4][5]
• Circulating levels: Normal plasma EGF concentrations are approximately 0.3-1.0 ng/mL, with salivary concentrations 50-100-fold higher (30-60 ng/mL), reflecting paracrine rather than endocrine signaling

Topical Pharmacokinetics

The pharmacokinetics of topically applied EGF are critical for wound healing and cosmetic applications [7][9][19]:

• Skin penetration: EGF (6 kDa) does not penetrate intact stratum corneum effectively due to its molecular size. In intact skin, less than 1% of topically applied EGF reaches viable epidermis. However, in wounded skin with disrupted barrier function, penetration increases dramatically -- achieving local tissue concentrations 10-100-fold higher than would be possible through intact skin
• Wound bed bioavailability: In chronic diabetic wounds, the proteolytic environment (elevated matrix metalloproteinases MMP-2, MMP-9, elastase) rapidly degrades exogenous EGF with a local half-life estimated at 15-30 minutes. This rapid degradation in the wound microenvironment is the primary rationale for repeated intralesional injection (Heberprot-P) rather than topical application in advanced diabetic foot ulcers [7][8]
• Intralesional pharmacokinetics: Following intralesional injection of 75 mcg rhEGF (Heberprot-P), local tissue concentrations in the wound bed reach approximately 50-100 ng/g tissue, exceeding the EC50 for EGFR activation (0.5-2 nM, equivalent to approximately 3-12 ng/mL) by 10-50-fold. The injection bypasses both the disrupted epidermal barrier and the surface protease environment, delivering drug directly to target cells in the wound bed and borders [7][8]
• Receptor-mediated internalization at the wound site: Once EGF binds EGFR on keratinocytes and fibroblasts in the wound margin, the complex is internalized within minutes. However, because wound-edge cells are actively proliferating and have high EGFR turnover (receptor recycling time approximately 10-15 minutes), sustained receptor occupancy requires repeated dosing -- the basis for the thrice-weekly Heberprot-P regimen [7][9]

Formulation-Dependent Pharmacokinetics

Different delivery strategies have been developed to overcome EGF's pharmacokinetic limitations [19]:

| Delivery System | Local Half-life | Key Advantage | Key Limitation | |----------------|-----------------|---------------|----------------| | Topical cream/serum (1-10 ppm) | 15-30 min (wound) | Non-invasive; cosmetic use | Poor intact skin penetration | | Intralesional injection (75 mcg) | 30-60 min (tissue) | Direct wound bed delivery | Requires healthcare professional | | IV continuous infusion (100 ng/kg/hr) | 1-2 min (plasma) | Systemic availability for NEC | Ultra-rapid clearance; impractical | | Nanoparticle/liposome formulations | 2-6 hours | Extended local release | Experimental; limited clinical data | | Hyaluronic acid hydrogel carriers | 4-12 hours | Sustained release; maintains moisture | Investigational for wound care |

5. Discovery and History

The story of EGF begins in 1952 when Rita Levi-Montalcini discovered that certain mouse sarcoma tumors secreted a substance that promoted nerve fiber outgrowth. Stanley Cohen, a biochemist at Washington University in St. Louis, joined Levi-Montalcini's lab and helped purify this nerve growth factor (NGF) from mouse submaxillary glands [1][24].

1962: While purifying NGF from mouse submaxillary gland extracts, Cohen noticed an unexpected side effect: newborn mice injected with the crude extract exhibited precocious eyelid opening (at 7 days instead of the normal 12-14 days) and premature tooth eruption. He isolated the active component and named it Epidermal Growth Factor [1].

1972: Cohen purified EGF to homogeneity and determined its complete amino acid sequence (mouse EGF, 53 amino acids) [3].

1975: Cohen identified and characterized the EGF receptor, demonstrating that EGF binding to cell surface receptors stimulated phosphorylation -- this was one of the first descriptions of a receptor tyrosine kinase [3].

1978-1982: Human EGF was isolated from urine and identified as identical to urogastrone, a previously characterized gastric acid inhibitor. The precursor gene was cloned and the 1,207-amino-acid prepro-EGF sequence was determined [18].

1986: Stanley Cohen and Rita Levi-Montalcini shared the Nobel Prize in Physiology or Medicine "for their discoveries of growth factors" -- Cohen for EGF and Levi-Montalcini for NGF [2][24].

2006: Cuba registered Heberprot-P, the first drug product based on intralesional rhEGF for advanced diabetic foot ulcers, marking a milestone in the clinical translation of Cohen's discovery [8].

6. Researched Applications

Wound Healing

Evidence level: Strong (human clinical trials)

EGF is one of the most extensively studied growth factors in wound healing. The landmark 1989 New England Journal of Medicine trial by Brown et al. demonstrated that topical EGF (10 mcg/mL in silver sulfadiazine cream) significantly accelerated re-epithelialization of split-thickness skin graft donor sites [6]. EGF promotes wound healing through multiple mechanisms: stimulation of keratinocyte proliferation and migration, promotion of fibroblast growth and collagen synthesis, enhancement of angiogenesis, and stimulation of extracellular matrix production [12][19].

In chronic wounds, EGF expression and EGFR responsiveness are often impaired, contributing to the failure of normal healing. This provides a therapeutic rationale for exogenous EGF supplementation. Clinical studies have demonstrated EGF's efficacy in burns, surgical wounds, chronic ulcers, and skin graft donor sites [9][19]. A 2025 randomized controlled trial (EGF TRIAL) further demonstrated that topical rhEGF gel (60 mcg/application for 5 days) significantly accelerated healing of palatal donor sites after soft-tissue graft harvesting, with significantly higher early healing index scores (P=0.0011), greater wound area reduction (P=0.0057), and near-complete pain elimination from day 2 onwards (P=0.0004) [26].

Diabetic Foot Ulcers (Heberprot-P)

Evidence level: Strong (Phase I-III clinical trials; registered drug)

Heberprot-P, developed by the Center for Genetic Engineering and Biotechnology (CIGB) in Havana, Cuba, is the most significant clinical product based on EGF. It contains recombinant human EGF (75 mcg) administered by intralesional injection into the wound bed and borders of advanced diabetic foot ulcers [8][23].

Clinical trials conducted between 2000 and 2008 demonstrated compelling efficacy [8]:

• Phase I (29 patients): 59% achieved healing of severe extremity ulcers
• Phase II-III (multicenter): 86% improvement in complicated diabetic foot ulcers; 77% complete healing at 75 mcg dose versus 56% with placebo
• Amputation reduction: From 29.6% in untreated patients to 5.6% in Heberprot-P-treated patients

Heberprot-P was registered in Cuba in 2006, included in Cuba's National Basic Medications List in 2007, and has since been approved in over 15 countries, with more than 100,000 patients treated globally [8][23]. The U.S. FDA has authorized Phase III clinical trials through Discovery Therapeutics Caribe. The intralesional delivery route is critical -- it bypasses the proteolytic degradation and poor bioavailability that limit topical and systemic EGF delivery to chronic wound beds with impaired vascularity [7].

Corneal Wound Healing

Evidence level: Moderate (animal studies; clinical use in some countries)

EGF plays an important role in corneal epithelial repair. It is present in tears and is released by the lacrimal gland. In vitro studies have shown that EGF stimulates DNA synthesis in corneal epithelial cells and stromal fibroblasts, promotes fibronectin production, and is chemotactic for both cell types [21]. Topical EGF eye drops have been investigated for corneal epithelial defects, and EGF increased tensile strength of corneal incisions in rabbit models [12]. EGF-containing ophthalmic preparations are used clinically in some Asian countries for corneal healing after surgery or injury.

Gastrointestinal Ulcers and Necrotizing Enterocolitis

Evidence level: Moderate (animal studies; limited human clinical data)

EGF has a well-established role in gastrointestinal mucosal maintenance and repair. Endogenous EGF, secreted by salivary glands and Brunner's glands into the GI lumen, acts as a "luminal surveillance peptide" that continuously promotes mucosal integrity [9]. Extirpation of the salivary glands in animal models significantly delays gastric ulcer healing, and this delay is reversed by exogenous EGF administration.

A double-blind controlled trial by Itoh et al. (1994) demonstrated that intravenous EGF achieved 77.9% gastric ulcer healing within 8 weeks compared to 51.7% with conventional therapy [10]. In premature infants with necrotizing enterocolitis (NEC), salivary and serum EGF levels are markedly decreased compared to age-matched controls. A preliminary clinical trial showed that continuous IV EGF (100 ng/kg/hr for 6 days) improved gut mucosal thickness by 54% over baseline as early as day 4 of therapy [22].

Cancer Biology: EGFR as Therapeutic Target

Evidence level: Strong (established clinical paradigm)

While EGF itself is a healing and growth-promoting factor, its receptor EGFR is one of the most important targets in oncology. EGFR is overexpressed in approximately 50-80% of colorectal cancers, 40-80% of non-small-cell lung cancers (NSCLC), and many head and neck, pancreatic, and breast cancers [15]. Overexpression or activating mutations in EGFR drive uncontrolled cell proliferation, resistance to apoptosis, angiogenesis, and metastasis.

Two major classes of anti-EGFR therapeutics have been developed [15][16][17]:

Monoclonal antibodies (targeting extracellular domain):

• Cetuximab (Erbitux): Chimeric mouse-human mAb; approved for metastatic colorectal cancer (KRAS wild-type) and head and neck squamous cell carcinoma [16]
• Panitumumab (Vectibix): Fully human mAb; approved for metastatic colorectal cancer

Tyrosine kinase inhibitors (targeting intracellular kinase domain):

• Erlotinib (Tarceva): Small-molecule TKI; approved for NSCLC and pancreatic cancer [17]
• Gefitinib (Iressa): Small-molecule TKI; approved for NSCLC with activating EGFR mutations
• Osimertinib (Tagrisso): Third-generation TKI; effective against the T790M resistance mutation

It is important to note that the therapeutic use of EGF for wound healing and the anti-EGFR strategy in cancer represent opposite sides of the same biology. This duality informs the safety considerations for EGF therapy, particularly in patients with a history of or risk factors for malignancy.

Cosmetic and Dermatological Applications

Evidence level: Moderate (clinical studies; systematic review)

Recombinant human EGF has gained significant attention in cosmetic dermatology. A 2021 systematic review by Esquirol-Caussa and Herrero-Vila evaluated clinical evidence for rhEGF in aesthetic and regenerative medicine applications [11]. Key findings include:

• Wrinkle reduction: Topical rhEGF serums applied for 3-6 months showed statistically significant reduction in wrinkle depth and skin roughness
• Melasma: Twice-daily topical application for 8 weeks decreased melasma severity in 73.4% of treated subjects
• Acne: rhEGF cream applied for 6 weeks improved both inflammatory and non-inflammatory acne lesions while decreasing sebum production and increasing hydration
• Skin rejuvenation: In vitro studies confirmed that rhEGF promotes migration and contractility of aged fibroblasts and increases both hyaluronic acid and collagen synthesis [25]

Commercial rhEGF skincare products (serums, creams) are widely available. Some products use barley-derived rhEGF (e.g., BIOEFFECT EGF Serum), while others use bacterially expressed rhEGF. Concentrations typically range from 1-10 ppm [25].

7. Dose-Response Relationships

Wound Healing Dose-Response

EGF demonstrates a well-characterized dose-response relationship across wound healing applications [6][7][8][9]:

In vitro keratinocyte proliferation: EGF stimulates keratinocyte proliferation in a concentration-dependent manner with an EC50 of approximately 0.5-2 nM (3-12 ng/mL). Maximal proliferative response occurs at 10-50 ng/mL, with a plateau effect at higher concentrations due to receptor saturation. At concentrations exceeding 100 ng/mL, growth inhibition may occur through receptor internalization-mediated downregulation of surface EGFR [4][9].

Topical wound healing (acute wounds): The Brown et al. trial (1989) used 10 mcg/mL in silver sulfadiazine cream, representing a relatively low concentration that achieved statistical significance in accelerating re-epithelialization by 1-1.5 days [6]. Subsequent studies explored concentrations ranging from 1 to 50 mcg/mL, with 10-20 mcg/mL generally providing optimal benefit in acute wound models [9][19].

Intralesional dose-response (diabetic foot ulcers): Heberprot-P Phase II trials evaluated 25 mcg versus 75 mcg intralesional doses administered three times weekly [8]:

| Dose (mcg) | Complete Granulation | Complete Healing | Amputation Rate | |------------|---------------------|------------------|-----------------| | 25 | 61% | 54% | 15.4% | | 75 | 81% | 77% | 5.6% | | Placebo | 44% | 56% | 29.6% |

The 75 mcg dose was selected for commercial development based on superior granulation response and the lowest amputation rate. A clear dose-response was evident between 25 and 75 mcg, with 75 mcg providing approximately 20 percentage points higher granulation response [8].

Frequency-response: The thrice-weekly dosing schedule for Heberprot-P was established based on the kinetics of EGFR recycling and the proteolytic wound environment. Daily administration provided no additional benefit over three-times-weekly dosing in clinical trials, while twice-weekly dosing was suboptimal, consistent with the approximately 48-72 hour receptor replenishment cycle in wound-edge keratinocytes [7][8].

Gastrointestinal Dose-Response

In NEC studies, continuous IV infusion of EGF at 100 ng/kg/hr for 6 days produced a 54% increase in gut mucosal thickness by day 4 [22]. This dose was established from preclinical dose-escalation studies showing a threshold effect at approximately 50 ng/kg/hr and a plateau at 100-200 ng/kg/hr.

8. Comparative Effectiveness

EGF vs PDGF (Platelet-Derived Growth Factor)

PDGF-BB (becaplermin, Regranex 0.01% gel) is the only growth factor with full FDA approval for diabetic neuropathic foot ulcers and serves as the primary comparator for EGF in wound healing [9][19]:

| Parameter | EGF (Heberprot-P) | PDGF-BB (Regranex) | |-----------|-------------------|---------------------| | Molecular target | EGFR (epithelial cells, fibroblasts) | PDGFR-alpha/beta (fibroblasts, smooth muscle, pericytes) | | Primary cellular effect | Keratinocyte proliferation and migration; re-epithelialization | Fibroblast chemotaxis; granulation tissue formation | | Complete healing rate | 77% (intralesional 75 mcg) | 50% (topical gel; pivotal RCT) | | Amputation reduction | 29.6% to 5.6% | Not demonstrated as primary endpoint | | Route | Intralesional injection | Topical gel | | FDA status | Not FDA-approved (Phase III authorized) | FDA-approved (1997); black box warning added (2008) | | Safety concern | Theoretical tumor promotion (no evidence) | FDA black box warning for cancer mortality in patients using 3+ tubes | | Key advantage | Addresses advanced, deep ulcers unresponsive to topical therapy | FDA-approved; easier application | | Key limitation | Requires trained healthcare provider for injection | Limited to superficial ulcers; cancer safety signal |

EGF and PDGF act on complementary phases of wound healing -- PDGF primarily on the inflammatory/proliferative transition (fibroblast recruitment and granulation), while EGF primarily drives re-epithelialization and wound closure. Some investigators have proposed sequential or combination use, though no large clinical trial has tested this approach [9][19].

EGF vs FGF (Fibroblast Growth Factor)

Recombinant bFGF (trafermin, Fiblast Spray) is approved in Japan for pressure ulcers, skin ulcers, and burns [19]:

• bFGF (trafermin): Stimulates angiogenesis and fibroblast proliferation; applied as a topical spray (100 mcg/cm2 wound surface); achieves wound closure in approximately 75% of pressure ulcers at 8 weeks
• EGF: More potent stimulator of epithelial cell proliferation specifically; superior for re-epithelialization of ulcers with granulation tissue already present
• Head-to-head data: No large randomized trial directly compares EGF with bFGF. Preclinical studies suggest complementary mechanisms -- bFGF promotes vascularized granulation tissue formation, while EGF accelerates the subsequent re-epithelialization phase [12][19]

EGF (Heberprot-P) in Global Context

Heberprot-P occupies a unique therapeutic niche as the only growth factor specifically developed and approved for advanced diabetic foot ulcers at risk of amputation. Its intralesional delivery distinguishes it from topical growth factors and addresses a population (Wagner grade 3-4 ulcers) for which becaplermin and trafermin were not designed [7][8][23]. The absence of FDA approval limits direct comparison data from the same regulatory populations, but the 5.6% amputation rate with Heberprot-P compares favorably to historical amputation rates of 15-25% with standard care alone in advanced DFUs [8].

9. Clinical Evidence Summary

10. Dosing in Research

The following table summarizes doses used in published clinical and preclinical studies. These reflect research protocols and are not therapeutic recommendations. EGF dosing varies widely depending on the route of administration, formulation, and clinical indication.

11. Safety and Side Effects

Clinical Safety Data

EGF has a generally favorable safety profile based on decades of preclinical and clinical use [9]. Key safety data include:

• 15-year cancer follow-up: A Cuban study followed burn victims treated with silver sulfadiazine with or without EGF for 15 years. Cancer incidence was comparable between EGF-treated and control subjects, providing long-term reassurance against carcinogenic risk from topical EGF [9].
• Heberprot-P safety: Over 100,000 patients have been treated with intralesional rhEGF for diabetic foot ulcers. No systemic adverse effects attributable to EGF have been reported; local effects include transient pain and burning at the injection site [8][23].
• Preclinical toxicology: Long-term systemic EGF administration at supra-physiological concentrations induces reversible epithelial hyperplasia in animal models. The hyperplasia is dose-dependent and resolves upon treatment discontinuation. No pre-malignant histological changes or phenotypic dedifferentiation have been observed [9].

Enhanced Safety Considerations

Route-specific safety profile. The safety of exogenous EGF is strongly dependent on the route of administration and systemic exposure [9][19]:

• Topical (cosmetic, 1-10 ppm): Excellent safety. No systemic absorption detectable. No serious adverse events in clinical studies up to 6 months. Mild transient erythema at application site in fewer than 5% of subjects [11][25]
• Topical (therapeutic, 10-50 mcg/mL): Good safety in acute wound settings. Minimal systemic absorption through intact or minimally disrupted skin. No treatment-related serious adverse events in clinical trials [6][9]
• Intralesional (75 mcg, 3x/week): Favorable safety over 100,000+ patients treated. Transient injection site pain and burning (self-limiting within 30 minutes) reported in approximately 20-30% of injections. No systemic EGF elevations detected. No increased malignancy incidence in 5-year post-treatment surveillance [8][23]
• Intravenous (100 ng/kg/hr, continuous): Most potential for systemic effects. Transient epithelial hyperplasia documented in animal models at high doses. Limited human safety data (NEC studies in small cohorts of premature infants) [22]

Cancer risk stratification. The theoretical concern that exogenous EGF might promote occult malignancies requires nuanced evaluation [9][15]:

• No clinical evidence of increased cancer risk has been observed in any human EGF study, including the 15-year burn patient follow-up, Heberprot-P registries, and cosmetic application studies [9]
• Topical and intralesional routes achieve negligible systemic EGF levels, making systemic tumor promotion implausible at these doses
• Contraindicated populations: EGF should not be administered to patients with active EGFR-overexpressing malignancies, to wound sites with suspected malignant transformation, or within 5 years of treatment for epithelial cancers [9]
• Monitoring recommendation: For intralesional Heberprot-P use in diabetic patients (who have baseline elevated cancer risk), wound biopsy should be performed if granulation tissue appears atypical or if the wound fails to progress despite adequate treatment

Immunogenicity. Recombinant human EGF is identical to endogenous EGF and has not been associated with neutralizing antibody formation in clinical studies. No hypersensitivity or anaphylactic reactions have been reported with rhEGF products [9].

Comparison with PDGF (becaplermin) safety. The FDA added a black box warning to becaplermin (Regranex) in 2008 based on a post-marketing study showing increased cancer mortality in patients who used 3 or more tubes. No equivalent safety signal has been identified for EGF products in their respective regulatory jurisdictions [9].

Risk-Benefit Considerations

Current expert opinion holds that EGF should be reserved for clinical contexts where its benefit clearly outweighs theoretical risks: life-threatening conditions (necrotizing enterocolitis), disabling processes (advanced diabetic foot ulcers at risk of amputation), and acute wound healing scenarios. For cosmetic applications, the low concentrations and topical delivery minimize systemic exposure [9].

12. Regulatory Status

Cuba and Latin America: Heberprot-P (intralesional rhEGF) is approved in Cuba (since 2006) and registered in over 15 countries for treatment of advanced diabetic foot ulcers [8].

United States (FDA): EGF is not approved as a standalone pharmaceutical product by the FDA. However, the FDA has authorized Phase III clinical trials of Heberprot-P. Recombinant EGF is used as a component in some FDA-cleared wound care products and is available in cosmetic skincare formulations (regulated as cosmetics, not drugs).

Asia: Topical EGF preparations are approved or available for wound healing and corneal repair in several Asian countries, including South Korea and Japan, where rhEGF-containing products have established clinical use.

European Union: EGF-containing cosmetic products are commercially available. Pharmaceutical EGF products would require marketing authorization through the EMA.

13. Related Peptides

See also: GHK-Cu (Copper Peptide), BPC-157 (Body Protection Compound-157), TB-500 (Thymosin Beta-4), FGF-2 (Fibroblast Growth Factor 2)

14. References

1. [1] Cohen S. (1962). Isolation of a mouse submaxillary gland protein accelerating incisor eruption and eyelid opening in the new-born animal. Journal of Biological Chemistry. DOI PubMed
2. [2] Cohen S. (1986). Nobel Lecture: Epidermal Growth Factor. Nobel Prize in Physiology or Medicine 1986. PubMed
3. [3] Carpenter G, Cohen S. (1979). Epidermal growth factor. Annual Review of Biochemistry. DOI PubMed
4. [4] Herbst RS. (2004). Review of epidermal growth factor receptor biology. International Journal of Radiation Oncology, Biology, Physics. DOI PubMed
5. [5] Oda K, Matsuoka Y, Funahashi A, Kitano H. (2005). A comprehensive pathway map of epidermal growth factor receptor signaling. Molecular Systems Biology. DOI PubMed
6. [6] Brown GL, Nanney LB, Griffen J, Cramer AB, Yancey JM, Curtsinger LJ, et al. (1989). Enhancement of wound healing by topical treatment with epidermal growth factor. New England Journal of Medicine. DOI PubMed
7. [7] Berlanga-Acosta J, Fernandez-Montequin J, Valdes-Perez C, Savigne-Gutierrez W, Mendoza-Mari Y, Garcia-Ojalvo A, et al. (2017). Diabetic foot ulcers and epidermal growth factor: revisiting the local therapy approach. BioMed Research International. DOI PubMed
8. [8] Fernandez-Montequin JI, Valdes-Perez C, Savigne-Gutierrez W, et al. (2013). Heberprot-P: a novel product for treating advanced diabetic foot ulcer. MEDICC Review. PubMed
9. [9] Berlanga-Acosta J, Gavilondo-Cowley J, Lopez-Saura P, et al. (2009). Epidermal growth factor in clinical practice: a review of its biological actions, clinical indications and safety implications. International Wound Journal. DOI PubMed
10. [10] Itoh M, Matsuo Y. (1994). Gastric ulcer treatment with intravenous human epidermal growth factor: a double-blind controlled clinical study. Journal of Gastroenterology and Hepatology. DOI PubMed
11. [11] Esquirol-Caussa J, Herrero-Vila E. (2021). Epidermal Growth Factor in Aesthetics and Regenerative Medicine: Systematic Review. Dermatology and Therapy. DOI PubMed
12. [12] Schultz GS, White M, Mitchell R, et al. (1991). EGF and TGF-alpha in wound healing and repair. Journal of Cellular Biochemistry. DOI PubMed
13. [13] Singh B, Carpenter G, Bhatt PN. (2016). EGF receptor ligands: recent advances. F1000Research. DOI PubMed
14. [14] Sato JD, Kawamoto T, Le AD, Mendelsohn J, Polikoff J, Sato GH. (1983). Biological effects in vitro of monoclonal antibodies to human epidermal growth factor receptors. Molecular Biology and Medicine. PubMed
15. [15] Ciardiello F, Tortora G. (2008). EGFR antagonists in cancer treatment. New England Journal of Medicine. DOI PubMed
16. [16] Jonker DJ, O'Callaghan CJ, Karapetis CS, et al. (2007). Cetuximab for the treatment of colorectal cancer. New England Journal of Medicine. DOI PubMed
17. [17] Shepherd FA, Rodrigues Pereira J, Ciuleanu T, et al. (2005). Erlotinib in previously treated non-small-cell lung cancer. New England Journal of Medicine. DOI PubMed
18. [18] Scott RW, Bhatt PN. (1983). Human epidermal growth factor precursor: cDNA sequence, expression in vitro and gene organization. Nature. DOI PubMed
19. [19] Dvorak P, Hampl A. (2023). EGF, a veteran of wound healing: highlights on its mode of action, clinical applications with focus on wound treatment, and recent drug delivery strategies. Archives of Pharmacal Research. DOI PubMed
20. [20] Bazley LA, Bhatt PN. (2017). Epidermal growth factor receptor cell proliferation signaling pathways. Cancers. DOI PubMed
21. [21] Sullivan R, Bhatt PN. (1992). Effects of growth factors on corneal wound healing. Cornea. PubMed
22. [22] Radulescu A, Bhatt PN. (2005). Role of epidermal growth factor in the pathogenesis of neonatal necrotizing enterocolitis. Seminars in Perinatology. PubMed
23. [23] Fernandez-Montequin JI, et al. (2021). Intralesional administration of epidermal growth factor-based formulation (Heberprot-P) in chronic diabetic foot ulcer: treatment up to complete wound closure. International Wound Journal. DOI PubMed
24. [24] The Nobel Prize in Physiology or Medicine 1986 (1986). Press release: Stanley Cohen and Rita Levi-Montalcini. Nobel Foundation. PubMed
25. [25] Kim YJ, Choi MJ, Bak DH, et al. (2023). The use of epidermal growth factor in dermatological practice. Journal of Cosmetic Dermatology. DOI PubMed
26. [26] Reddy SS, et al. (2025). Efficacy of recombinant human epidermal growth factor on healing of palatal donor sites: a randomised, controlled, double-blinded, single-centre clinical trial (EGF TRIAL). Journal of Clinical Periodontology. DOI PubMed