1. Overview
LL-37 is the sole cathelicidin-derived antimicrobial peptide identified in humans. It is a 37-amino acid, amphipathic, alpha-helical peptide with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, and enveloped viruses [1][29]. Beyond its direct microbicidal properties, LL-37 functions as a potent immunomodulator, influencing chemotaxis, cytokine production, dendritic cell maturation, and wound healing [7][22].
The name "LL-37" derives from its two N-terminal leucine residues and its 37-residue length. Its primary sequence is LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, carrying a net positive charge of +6 at physiological pH. This cationic character drives electrostatic interactions with negatively charged microbial membranes, which forms the basis of its antimicrobial mechanism [26].
LL-37 is proteolytically cleaved from the C-terminal domain of the 18 kDa precursor protein hCAP-18 (human cationic antimicrobial protein 18), encoded by the CAMP gene on chromosome 3p21.31 [1]. In neutrophils, hCAP-18 is stored in specific (secondary) granules and released upon degranulation, after which extracellular cleavage by proteinase 3 generates the mature LL-37 peptide. In skin, processing is mediated by kallikrein 5 (KLK5) and kallikrein 7 (KLK7) [4].
A landmark discovery established that LL-37 expression is directly regulated by vitamin D through a vitamin D response element (VDRE) in the CAMP gene promoter [2]. This connection has profound implications for understanding the relationship between vitamin D status and innate immune defense, particularly against tuberculosis and respiratory infections.
- Molecular Weight
- 4493.33 Da
- Sequence
- LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (37 amino acids)
- Net Charge
- +6 at physiological pH
- Structure
- Amphipathic alpha-helix
- Precursor
- hCAP-18 (human cationic antimicrobial protein 18, 170 amino acids)
- Gene
- CAMP (chromosome 3p21.31)
- Processing Enzyme
- Proteinase 3 (neutrophils); KLK5/KLK7 (skin)
- Expression
- Neutrophils, epithelial cells, macrophages, mast cells; induced by vitamin D
- Routes Studied
- Topical, intratumoral injection, intravenous (preclinical)
- Regulatory Status
- Investigational; Phase I/II clinical trials completed
2. Mechanism of Action
2.1 Antimicrobial Activity
LL-37 exerts antimicrobial activity through membrane disruption via two primary mechanisms [26]:
Carpet model. At bacterial membrane surfaces, LL-37 molecules accumulate in parallel orientation on the negatively charged lipid bilayer in a carpet-like fashion. Above a threshold concentration, the accumulated peptide molecules cause membrane disintegration through a detergent-like mechanism.
Toroidal pore formation. LL-37 oligomerizes and forms transmembrane pores in lipid bilayers. Cryo-electron microscopy and X-ray crystallography studies have confirmed oligomerization and channel formation in membrane-mimicking environments [26]. The selectivity for microbial over mammalian membranes arises from the differential lipid composition: bacterial membranes are enriched in negatively charged phospholipids (phosphatidylglycerol, cardiolipin), while mammalian cell membranes contain predominantly zwitterionic phosphatidylcholine and cholesterol.
Research has documented antimicrobial efficacy against more than 38 bacterial species, 16 fungal species, and 16 viruses, making LL-37 one of the broadest-spectrum natural antimicrobial agents known.
2.2 Immunomodulation
LL-37 functions as a multifaceted immunomodulator with both pro- and anti-inflammatory properties depending on context:
Chemotaxis. LL-37 recruits neutrophils, monocytes, T cells, and mast cells via formyl peptide receptor-like 1 (FPRL1/FPR2), promoting innate immune cell accumulation at sites of infection [6].
Anti-endotoxin activity. LL-37 directly binds and neutralizes bacterial lipopolysaccharide (LPS), reducing pro-inflammatory signaling through inhibition of Toll-like receptor 4 (TLR4) pathway activation. This property has been exploited in preclinical sepsis research [14][15][16].
TLR modulation. LL-37 modulates innate immune signaling through multiple TLR pathways. It inhibits TLR-mediated pro-inflammatory responses partly through inhibition of p38 MAP kinase phosphorylation, while simultaneously enhancing certain antiviral TLR responses.
Cytokine modulation. LL-37 exerts context-dependent effects on cytokine production, modulating IL-1β, TNF-α, IL-6, IL-8, and IL-10 in a manner that depends on the inflammatory milieu and cell type.
Dendritic cell maturation. LL-37 promotes differentiation of monocytes into dendritic cells, bridging innate and adaptive immunity. This property is particularly relevant to its anti-tumor immune effects [3].
2.3 Vitamin D–Cathelicidin Axis
The discovery that vitamin D directly regulates LL-37 expression represents one of the most significant advances in innate immunity research [2]. Liu et al. (2006) demonstrated in a landmark Science paper that TLR2/1 activation of human macrophages upregulates the vitamin D receptor (VDR) and CYP27B1 (the enzyme converting 25-hydroxyvitamin D to active 1,25-dihydroxyvitamin D), leading to cathelicidin induction and killing of intracellular Mycobacterium tuberculosis [2]. Critically, sera from individuals with low 25(OH)D levels were inefficient at supporting this antimicrobial response, providing a molecular explanation for the long-observed association between vitamin D deficiency and susceptibility to tuberculosis.
Subsequent work confirmed that 200 μg/mL of LL-37 reduced M. tuberculosis growth in culture by 75.7% [23]. This vitamin D–cathelicidin axis has stimulated extensive research into vitamin D supplementation as a strategy to enhance innate immune defense against infectious diseases.
3. Researched Applications
Wound Healing (Clinical Trial Evidence)
The most advanced clinical application of LL-37 is in chronic wound healing. LL-37 promotes wound repair through stimulation of angiogenesis, keratinocyte migration, and epithelial proliferation.
In the pivotal Phase I/IIa randomized controlled trial, Grönberg et al. (2014) evaluated topical LL-37 in 34 patients with chronic venous leg ulcers [7]. Patients received LL-37 at concentrations of 0.5, 1.6, or 3.2 mg/mL applied twice weekly for 4 weeks. The healing rate constants for the 0.5 mg/mL and 1.6 mg/mL groups were approximately 6-fold and 3-fold higher than placebo respectively (p=0.003 for 0.5 mg/mL). Mean ulcer area decreased by 68% with 0.5 mg/mL LL-37 and 50% with 1.6 mg/mL. Notably, no effect was observed at the highest concentration (3.2 mg/mL), suggesting an inverted dose-response relationship. No safety concerns were identified.
A subsequent Phase IIb multicenter trial (Grönberg et al., 2022) enrolled 148 patients with hard-to-heal venous leg ulcers and confirmed the wound healing enhancement demonstrated in the earlier trial [8].
In diabetic foot ulcers, Arini et al. (2023) conducted a randomized double-blind trial in 25 patients [9]. LL-37 cream applied twice weekly for 4 weeks produced consistently greater granulation tissue formation than placebo at all time points measured (days 7, 14, 21, and 28; p-values ranging from 0.006 to 0.037).
Preclinical studies have further demonstrated that LL-37 encapsulated in chitosan hydrogel significantly reduced pressure ulcer area in mice, with increased epithelial thickness and capillary density [22].
Biofilm Disruption (Strong Preclinical Evidence)
One of the most remarkable properties of LL-37 is its ability to prevent and disrupt bacterial biofilms at concentrations far below those required for planktonic killing.
Overhage et al. (2008) demonstrated that LL-37 inhibited Pseudomonas aeruginosa biofilm formation at just 0.5 μg/mL — more than 100-fold below its minimum inhibitory concentration of 64 μg/mL [5]. At these sub-inhibitory concentrations, LL-37 affected twitching motility, quorum-sensing gene expression, and initial bacterial attachment, disrupting the earliest stages of biofilm development.
Koppen et al. (2019) showed that LL-37 achieved greater than 4-log reduction in Staphylococcus aureus biofilm colony counts, with greater than 3-log reduction occurring within just 5 minutes of treatment [19]. Dean et al. (2011) identified fragments LL7-37 and LL-31 as having the strongest anti-biofilm activity at sub-MIC concentrations against P. aeruginosa [20].
This biofilm-disrupting activity is particularly clinically relevant given that biofilm-associated infections account for an estimated 65-80% of all bacterial infections and are notoriously resistant to conventional antibiotics.
Anti-Infective Activity (Broad Preclinical Evidence)
Bacterial infections. LL-37 demonstrates activity against both extracellular and intracellular pathogens. Noore et al. (2013) showed that LL-37 killed both planktonic and intracellular S. aureus within human keratinocytes [10], demonstrating cell-penetrating antimicrobial capacity. Bals et al. (1998) established that LL-37 is expressed in airway epithelial cells where it provides broad antimicrobial activity at the airway surface [29]. Majewski et al. (2019) found that serum LL-37 levels were significantly elevated in pneumonia patients with Gram-positive infections but reduced in those with opportunistic Gram-negative bacteria, suggesting impaired innate defense in the latter group [25].
Antiviral activity (including SARS-CoV-2). Wang et al. (2021) demonstrated that LL-37 binds the SARS-CoV-2 spike protein receptor-binding domain with a dissociation constant (Kd) of 11.2 nM and inhibited pseudovirion infection with an IC50 of 4.74 μg/mL [11]. LL-37 also bound ACE2 (Kd = 25.5 nM), effectively cloaking the viral entry receptor. Intranasal administration in mice decreased lung pseudovirion infection. An inverse correlation between LL-37 levels and COVID-19 severity has been reported [12], and niacinamide has been shown to enhance LL-37's antiviral activity through hydrotropic augmentation of peptide bioavailability [13].
Antifungal activity. LL-37 and its analogs demonstrate activity against Candida species and other pathogenic fungi [27].
Sepsis (Preclinical Evidence)
LL-37 has shown consistent benefit across multiple preclinical sepsis models. Torossian et al. (2007) demonstrated that intravenous LL-37 significantly improved survival in three rat sepsis models: LPS injection, intravenous E. coli challenge, and cecal ligation and puncture [14]. The mechanism involves a combination of direct bactericidal activity, LPS neutralization, and immunomodulation.
Nagaoka et al. (2020) showed that LL-37 suppressed macrophage pyroptosis, enhanced neutrophil extracellular trap (NET) release, and exhibited direct bactericidal and LPS-neutralizing activities in a murine sepsis model [15]. Kumagai et al. (2020) identified a novel mechanism whereby LL-37 improved survival through induction of microvesicle release from neutrophils [16]. Hu et al. (2024) demonstrated that CRAMP (the murine homolog of LL-37) at doses of 2.5-5.0 mg/kg reduced sepsis-induced acute lung injury by suppressing alveolar epithelial cell pyroptosis [17].
Cancer Immunotherapy (Emerging Evidence)
LL-37's role in cancer is complex and tissue-dependent, with both anti-tumor and pro-tumor effects documented:
Anti-tumor effects. A Phase I clinical trial (NCT02225366) at MD Anderson Cancer Center evaluated intratumoral injections of LL-37 in melanoma patients with cutaneous metastases. Weekly injections for up to 8 weeks demonstrated anti-tumor potency through activation of plasmacytoid dendritic cells and TLR9-mediated immune responses. In gastric and colon cancers, LL-37 has been shown to increase nuclear levels of AIF and EndoG, inducing caspase-independent apoptosis [30].
Pro-tumor effects. In ovarian cancer, Coffelt et al. (2009) demonstrated that LL-37 overexpression promoted recruitment of mesenchymal stromal cells to the tumor stroma, enhancing tumor engraftment and metastasis [6]. Cheng et al. (2019) showed that myeloid cell-derived LL-37 promotes lung cancer growth through Wnt/β-catenin signaling activation [21].
The tissue-specific nature of these effects — anti-tumor in melanoma, gastric, and colon cancers; pro-tumor in ovarian, breast, and lung cancers — underscores the importance of context in evaluating LL-37's therapeutic potential in oncology.
Skin Diseases (Mechanistic Insights)
Psoriasis. In a landmark 2007 Nature paper, Lande et al. demonstrated that LL-37 converts inert self-DNA into a potent trigger of interferon production [3]. LL-37 forms condensed complexes with self-DNA that are delivered to early endocytic compartments in plasmacytoid dendritic cells, activating TLR9 and breaking innate tolerance to self-DNA. This mechanism drives the type I interferon response characteristic of psoriatic inflammation. Ganguly et al. (2009) extended this finding to self-RNA, showing that LL-37/RNA complexes activate dendritic cells through TLR7 and TLR8 [24].
Rosacea. Yamasaki et al. (2007) established that rosacea patients express abnormally high levels of cathelicidin [4]. Aberrant processing by kallikrein 5 (KLK5) generates peptide fragments distinct from normal LL-37 that trigger inflammation, erythema, and telangiectasia. Injection of these abnormal fragments into mouse skin reproduced rosacea-like changes. This discovery provided a molecular basis for the efficacy of azelaic acid in rosacea treatment, as it inhibits KLK5 activity and cathelicidin processing.
Inflammatory Bowel Disease (Observational Evidence)
Kusaka et al. (2018) demonstrated that LL-37 mRNA was significantly increased in inflamed mucosa of ulcerative colitis patients [18]. The peptide's dual role — antimicrobial defense at mucosal surfaces versus potential pro-inflammatory amplification through formation of LL-37/DNA complexes that activate TLR9 — highlights its complex biology in the gastrointestinal tract. Serum cathelicidin levels have been inversely correlated with IBD disease activity, suggesting a protective role when present systemically.
4. Clinical Evidence Summary
| Study | Year | Type | Subjects | Key Finding |
|---|---|---|---|---|
| Grönberg et al. — Venous Leg Ulcers Phase I/IIa | 2014 | Randomized controlled trial | 34 | Topical LL-37 at 0.5 mg/mL and 1.6 mg/mL applied twice weekly for 4 weeks produced healing rate constants approximately 6-fold and 3-fold higher than placebo respectively (p=0.003 for 0.5 mg/mL). Mean ulcer area decreased by 68% with 0.5 mg/mL LL-37. |
| Grönberg et al. — Venous Leg Ulcers Phase IIb | 2022 | Randomized controlled trial | 148 | Multicenter Phase IIb trial of topical LL-37 in hard-to-heal venous leg ulcers confirmed wound healing enhancement demonstrated in the Phase I/IIa trial. |
| Arini et al. — Diabetic Foot Ulcers | 2023 | Randomized controlled trial | 25 | LL-37 cream applied twice weekly for 4 weeks produced consistently greater granulation tissue formation than placebo at days 7, 14, 21, and 28 (p=0.031, 0.009, 0.006, 0.037 respectively) in diabetic foot ulcer patients. |
| Liu et al. — Vitamin D and Cathelicidin in TB | 2006 | Mechanistic (in vitro/ex vivo) | TLR2/1 activation of human macrophages upregulated VDR and CYP27B1, leading to cathelicidin induction and intracellular killing of Mycobacterium tuberculosis. Sera from individuals with low 25(OH)D were inefficient at supporting cathelicidin induction. | |
| Lande et al. — LL-37/Self-DNA in Psoriasis | 2007 | Mechanistic study | LL-37 converts inert self-DNA into a potent trigger of interferon production by forming condensed complexes delivered to early endocytic compartments in plasmacytoid dendritic cells, activating TLR9 and breaking innate tolerance to self-DNA in psoriasis. | |
| Yamasaki et al. — Cathelicidin in Rosacea | 2007 | Mechanistic study | Rosacea patients express abnormally high cathelicidin levels. Aberrant processing by KLK5 generates distinct peptide fragments that trigger inflammation and erythema. Injection of these peptides into mouse skin reproduced rosacea-like changes. | |
| Overhage et al. — Biofilm Prevention | 2008 | In vitro study | LL-37 inhibited P. aeruginosa biofilm formation at 0.5 μg/mL, a concentration more than 100-fold below the MIC (64 μg/mL), by affecting twitching motility, quorum-sensing gene expression, and initial attachment. | |
| Koppen et al. — S. aureus Biofilm Killing | 2019 | In vitro study | LL-37 produced greater than 4-log reduction in S. aureus biofilm colony counts, with greater than 3-log reduction achieved within 5 minutes of treatment. | |
| Wang et al. — LL-37 Inhibits SARS-CoV-2 | 2021 | In vitro/in vivo study | LL-37 bound the SARS-CoV-2 spike protein RBD with Kd of 11.2 nM and inhibited pseudovirion infection with IC50 of 4.74 μg/mL. Intranasal LL-37 administration in mice decreased lung pseudovirion infection. | |
| Coffelt et al. — LL-37 in Ovarian Cancer | 2009 | In vitro/in vivo study | LL-37 overexpression in ovarian cancer cells promoted recruitment of multipotent mesenchymal stromal cells to tumor stroma, enhancing tumor engraftment and metastasis via FPRL1-dependent signaling. | |
| Torossian et al. — LL-37 in Sepsis | 2007 | In vivo (animal) | Intravenous LL-37 significantly improved survival in three experimental rat sepsis models: LPS injection, intravenous E. coli challenge, and cecal ligation and puncture. | |
| Nagaoka et al. — Cathelicidin in Sepsis Model | 2020 | In vivo (animal) | LL-37 suppressed macrophage pyroptosis, enhanced neutrophil extracellular trap release, and exhibited direct bactericidal and LPS-neutralizing activities in a murine sepsis model. | |
| Kumagai et al. — Sepsis Microvesicle Release | 2020 | In vivo (animal) | LL-37 improved survival in CLP septic mice through induction of microvesicle release from neutrophils and reduction of bacterial load. | |
| Hu et al. — Sepsis-Induced Acute Lung Injury | 2024 | In vivo (animal) | CRAMP (murine LL-37 analog) at doses of 2.5 and 5.0 mg/kg reduced sepsis-induced acute lung injury markers by suppressing pyroptosis in alveolar epithelial cells. | |
| Kusaka et al. — LL-37 in IBD | 2018 | Observational/mechanistic | LL-37 mRNA was significantly increased in inflamed mucosa of ulcerative colitis. Poly(I:C) (TLR-3 ligand) induced LL-37 expression in colonic subepithelial myofibroblasts. | |
| Noore et al. — Intracellular S. aureus Killing | 2013 | In vitro study | LL-37 was effective against both extracellular and intracellular Staphylococcus aureus in human keratinocytes, demonstrating cell-penetrating antimicrobial activity. | |
| LL-37 Melanoma Phase I (NCT02225366) | 2016 | Phase I clinical trial | Intratumoral injections of LL-37 in melanoma patients with cutaneous metastases demonstrated anti-tumor potency through activation of plasmacytoid dendritic cells and TLR9-mediated immune responses. |
5. Dosing in Research
LL-37 has been investigated via multiple routes of administration, with dosing varying substantially by indication and study design. The most robust dosing data come from the wound healing clinical trials.
For venous leg ulcers, the Phase I/IIa trial established an optimal topical concentration of 0.5-1.6 mg/mL applied twice weekly [7]. Paradoxically, the highest tested concentration (3.2 mg/mL) showed no benefit, consistent with LL-37's known cytotoxicity to mammalian cells at higher concentrations.
In preclinical sepsis models, effective intravenous doses ranged from 2.5 to 5.0 mg/kg in mice [17].
| Study / Context | Route | Dose | Duration |
|---|---|---|---|
| Grönberg et al. 2014 (VLU Phase I/IIa) | Topical | 0.5, 1.6, or 3.2 mg/mL | Twice weekly for 4 weeks |
| Grönberg et al. 2022 (VLU Phase IIb) | Topical | LL-37 formulation | Applied to wound bed |
| Arini et al. 2023 (DFU) | Topical cream | LL-37 cream | Twice weekly for 4 weeks |
| NCT02225366 (Melanoma) | Intratumoral injection | Escalating doses | Weekly for up to 8 weeks |
| Preclinical sepsis models | Intravenous | 2.5-5.0 mg/kg | Single or multiple doses |
6. Pharmacokinetics
Topical Administration (Wound Healing)
LL-37 pharmacokinetics following topical application to chronic wounds differ substantially from systemic administration:
- Local bioavailability: Topically applied LL-37 remains predominantly at the wound bed. Penetration into intact skin is minimal due to the peptide's size (4.5 kDa) and charge (+6), but absorption through damaged epithelium in chronic ulcers is enhanced.
- Local tissue half-life: Estimated at 4-8 hours in wound fluid, depending on protease activity. LL-37 is susceptible to degradation by wound proteases including elastase, cathepsin D, and matrix metalloproteinases (MMPs), which are elevated in chronic wound fluid.
- Systemic absorption: Negligible from topical wound application at clinical concentrations (0.5-3.2 mg/mL). No measurable changes in plasma LL-37 levels were observed in the Phase I/IIa trial [7].
- Protein binding in wound fluid: LL-37 binds extensively to wound fluid proteins, glycosaminoglycans, and extracellular DNA, which can reduce free peptide concentration but may also serve as a slow-release reservoir.
Endogenous LL-37 Pharmacokinetics
- Plasma concentrations: Normal basal plasma LL-37 levels in healthy adults range from 0.5-3.0 mcg/mL, with higher levels in active infections (up to 15-20 mcg/mL in pneumonia patients) [25]
- Neutrophil release: Upon degranulation, individual neutrophils release approximately 35-62 pg of hCAP-18/LL-37. At sites of acute inflammation, local concentrations can reach 5-100 mcg/mL.
- Protein binding: Extensively bound to plasma lipoproteins, particularly apolipoprotein A-I in HDL particles, and to albumin. Protein binding reduces antimicrobial activity but extends circulating half-life and reduces systemic cytotoxicity.
- Metabolism: Proteolytically degraded by serum proteases. In skin, KLK5 and KLK7 process hCAP-18 into LL-37 and further fragments. In neutrophils, proteinase 3 is the primary processing enzyme [1][4].
Intravenous/Systemic (Preclinical)
- Half-life: Estimated at 15-30 minutes in murine models due to rapid proteolytic degradation and renal clearance
- Volume of distribution: Broadly distributed to tissues with high antimicrobial demand (lung, skin, GI tract)
- Renal clearance: Peptide fragments are renally cleared; the intact 37-residue peptide is rapidly proteolyzed
7. Dose-Response Relationships
Wound Healing (Topical)
The wound healing dose-response for LL-37 follows an inverted U-shaped curve, a hallmark finding from the clinical trial program:
- 0.5 mg/mL: Optimal concentration; healing rate constant approximately 6-fold higher than placebo (p=0.003). Mean ulcer area decreased by 68% over 4 weeks [7].
- 1.6 mg/mL: Intermediate efficacy; healing rate constant approximately 3-fold higher than placebo. Mean ulcer area decreased by 50% [7].
- 3.2 mg/mL: No significant healing benefit over placebo, consistent with cytotoxic effects at higher concentrations [7].
- Biological explanation: At lower concentrations, LL-37 promotes keratinocyte migration, angiogenesis, and epithelial proliferation. At higher concentrations, cytotoxicity to host cells (threshold approximately 1-10 mcM or 4.5-45 mcg/mL) counteracts the pro-healing effects.
Antimicrobial Activity (In Vitro)
- Biofilm prevention (P. aeruginosa): Effective at 0.5 mcg/mL, which is more than 100-fold below the MIC of 64 mcg/mL [5]
- Planktonic killing: MIC values range from 2-64 mcg/mL depending on species: S. aureus 8-32 mcg/mL; E. coli 2-8 mcg/mL; P. aeruginosa 32-64 mcg/mL; C. albicans 8-16 mcg/mL
- Biofilm eradication (S. aureus): Greater than 4-log reduction at concentrations above MIC, with greater than 3-log reduction within 5 minutes [19]
- Antiviral activity (SARS-CoV-2): IC50 of 4.74 mcg/mL for pseudovirion inhibition; Kd of 11.2 nM for spike protein RBD binding [11]
Cytotoxicity Threshold
- Mammalian cell toxicity: Onset at approximately 1-10 mcM (4.5-45 mcg/mL), depending on cell type
- Hemolysis: 3-5% at therapeutic concentrations; significant hemolysis (more than 50%) at concentrations above 50 mcg/mL
- Therapeutic index: Approximately 5-10 fold window between effective antimicrobial concentrations and host cell cytotoxicity for most bacterial targets, but narrower for organisms with higher MICs (e.g., P. aeruginosa)
8. Comparative Effectiveness
LL-37 vs. SAAP-148 (Advanced Derivative)
SAAP-148 is a synthetic derivative of LL-37 designed for enhanced antimicrobial potency and protease stability:
- Antimicrobial potency: SAAP-148 demonstrates 4-16 fold lower MICs than native LL-37 against most tested pathogens, including MRSA, VRE, and multidrug-resistant Gram-negative bacteria
- Protease stability: SAAP-148 retains antimicrobial activity in the presence of human plasma (50%), whereas LL-37 loses most activity within 1-2 hours due to proteolytic degradation
- Cytotoxicity tradeoff: SAAP-148 shows significant host cell cytotoxicity (cell viability approximately 14.9% at 25 mcM), substantially worse than native LL-37 [28]
- Optimized analogs: SAAP-4 and SAAP-7 achieve improved selectivity indices. SAAP-7 maintains 98.2% cell viability at 25 mcM while retaining enhanced antimicrobial activity [28]
- Clinical status: SAAP-148 is in preclinical development; no clinical trials have been completed
LL-37 vs. Ceragenins (Synthetic Lipid Mimetics)
Ceragenins (cationic steroid antimicrobials, CSAs) are non-peptide amphiphilic compounds inspired by LL-37's mechanism:
- Protease resistance: Ceragenins are completely resistant to proteolytic degradation, a major advantage over LL-37
- Production cost: Lower cost of synthesis compared to 37-residue peptide synthesis
- Antimicrobial spectrum: Comparable broad-spectrum activity to LL-37, including biofilm disruption
- Immunomodulation: Ceragenins lack the immunomodulatory and wound-healing promoting activities of LL-37 (chemotaxis, DC maturation, cytokine modulation), as these functions depend on specific peptide-receptor interactions (FPRL1/FPR2)
- Clinical development: CSA-13 and CSA-131 are the most advanced ceragenins; preclinical only
LL-37 vs. Conventional Antibiotics (Biofilm Context)
- Sub-MIC biofilm activity: LL-37 prevents biofilm formation at 0.5 mcg/mL (1/128 of MIC), a property not shared by any conventional antibiotic class
- Biofilm penetration: LL-37 kills established S. aureus biofilm bacteria within 5 minutes, whereas vancomycin requires days to achieve comparable reductions and often fails to eradicate biofilm
- Resistance development: No bacterial resistance to LL-37 has been documented through serial passage experiments (more than 30 passages), compared to rapid resistance emergence with conventional antibiotics
- Synergies: LL-37 synergizes with rifampin, colistin, and azithromycin against biofilm-associated infections
LL-37 vs. Pexiganan (Magainin Derivative)
Pexiganan (MSI-78) is a synthetic analog of magainin-2, a frog-derived antimicrobial peptide that reached Phase III trials for diabetic foot infections:
- Clinical evidence: Pexiganan showed non-inferiority to oral ofloxacin in Phase III but was not approved by the FDA (twice rejected, 1999 and 2017). LL-37 has Phase IIb data in wound healing with positive results [7][8].
- Mechanism: Both are membrane-disrupting cationic peptides; LL-37 has additional immunomodulatory and wound-healing activities that pexiganan lacks
- Therapeutic niche: LL-37's dual antimicrobial/wound healing activity positions it uniquely for chronic wound management
9. Safety and Side Effects
Cytotoxicity threshold. LL-37 becomes cytotoxic to mammalian cells at concentrations of approximately 1-10 mcM (4.5-45 mcg/mL). The specific threshold varies by cell type:
- Keratinocytes: approximately 10 mcM (relatively resistant)
- PBMCs: approximately 5-10 mcM
- Endothelial cells: approximately 5 mcM
- Erythrocytes: significant hemolysis above 10-15 mcM This narrow therapeutic window between antimicrobial efficacy and host cell toxicity is a key consideration in therapeutic development.
Hemolysis. At therapeutic doses, LL-37 produces minimal hemolysis (3-5% lysis of uninfected erythrocytes in vitro at concentrations up to 25 mcg/mL). At 50 mcg/mL, hemolysis increases to 15-25%. At 100 mcg/mL, hemolysis exceeds 50%. In vivo, cytotoxic effects in the circulation are partially mitigated by binding to plasma proteins including apolipoprotein A-I and albumin, though this binding also reduces antimicrobial potency.
Clinical trial safety (quantitative). Safety data from completed clinical trials:
- Phase I/IIa VLU trial (n=34): Zero treatment-related serious adverse events across all dose groups (0.5, 1.6, 3.2 mg/mL). No local toxicity, no systemic effects, no immunogenicity concerns [7].
- Phase IIb VLU trial (n=148): Confirmed favorable safety profile from the earlier trial [8].
- Diabetic foot ulcer trial (n=25): No treatment-related adverse events reported. No local irritation, infection, or hypersensitivity reactions [9].
- Phase I melanoma trial (intratumoral injection): Local injection site reactions (erythema, mild pain) were the most common adverse events; no dose-limiting toxicities reported.
- Across all completed human trials (more than 200 subjects), no drug-related SAEs have been reported.
Pro-inflammatory potential. Through its ability to form complexes with self-nucleic acids and activate TLR signaling, LL-37 can amplify autoimmune inflammation in susceptible individuals, as demonstrated in psoriasis and potentially systemic lupus erythematosus [3]. LL-37/self-DNA complexes activate TLR9 on plasmacytoid dendritic cells, and LL-37/self-RNA complexes activate TLR7/8 on conventional dendritic cells [24]. This immunostimulatory property must be carefully considered in therapeutic applications.
Dose-response considerations. The inverted dose-response relationship observed in wound healing (optimal at lower concentrations, ineffective at higher doses) suggests that LL-37 therapeutic applications require precise dosing to balance efficacy against cytotoxicity. The therapeutic window for topical wound healing appears to be 0.5-1.6 mg/mL based on Phase I/IIa data [7].
10. Synthetic Analogs and Derivatives
The limitations of native LL-37 — including susceptibility to protease degradation, narrow therapeutic window, and high production costs — have driven development of improved analogs:
SAAP-148 is the most advanced LL-37 derivative, exhibiting enhanced stability against plasma proteases and superior efficacy against multidrug-resistant pathogens without inducing resistance. However, it shows significant cytotoxicity (cell viability approximately 14.9% at 25 μM). Optimized analogs SAAP-4 and SAAP-7 show dramatically reduced cytotoxicity, with SAAP-7 maintaining 98.2% cell viability at the same concentration [28].
Ceragenins (CSAs) are synthetic lipid compounds based on bile acid scaffolds that mimic LL-37's amphiphilic character. They offer advantages including resistance to protease degradation and lower production costs.
Truncated fragments under investigation include FK-16 (residues 17-32, potent antimicrobial activity), LL7-37, and LL-31 (enhanced anti-biofilm activity) [20].
11. Related Peptides
See also: Melittin, Magainin-2, Pexiganan, Brilacidin, Thymosin Alpha-1
12. References
- [1] Sørensen OE, Follin P, Johnsen AH, et al. (2001). Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood. DOI PubMed
- [2] Liu PT, Stenger S, Li H, et al. (2006). Toll-like receptor triggering of a vitamin D-mediated human antimicrobial response. Science. DOI PubMed
- [3] Lande R, Gregorio J, Facchinetti V, et al. (2007). Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide. Nature. DOI PubMed
- [4] Yamasaki K, Di Nardo A, Bardan A, et al. (2007). Increased serine protease activity and cathelicidin promotes skin inflammation in rosacea. Nature Medicine. DOI
- [5] Overhage J, Campisano A, Ciber M, et al. (2008). Human host defense peptide LL-37 prevents bacterial biofilm formation. Infection and Immunity. DOI PubMed
- [6] Coffelt SB, Marini FC, Watson K, et al. (2009). The pro-inflammatory peptide LL-37 promotes ovarian tumor progression through recruitment of multipotent mesenchymal stromal cells. Proceedings of the National Academy of Sciences. DOI PubMed
- [7] Grönberg A, Mahlapuu M, Ståhle M, et al. (2014). Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial. Wound Repair and Regeneration. DOI PubMed
- [8] Grönberg A, Zettergren L, Agren MS, et al. (2022). Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial. Wound Repair and Regeneration.
- [9] Arini HF, Widodo W, Alfarabi M, et al. (2023). Efficacy of LL-37 cream in enhancing healing of diabetic foot ulcer: a randomized double-blind controlled trial. Archives of Dermatological Research. DOI PubMed
- [10] Noore J, Noore A, Li B. (2013). Cationic antimicrobial peptide LL-37 is effective against both extra- and intracellular Staphylococcus aureus. Antimicrobial Agents and Chemotherapy. DOI
- [11] Wang C, Wang S, Li D, et al. (2021). Human cathelicidin inhibits SARS-CoV-2 infection: killing two birds with one stone. ACS Infectious Diseases. DOI PubMed
- [12] Lokhande KB, Banerjee T, Swamy KV, et al. (2022). Upregulating Human Cathelicidin Antimicrobial Peptide LL-37 Expression May Prevent Severe COVID-19 Inflammatory Responses and Reduce Microthrombosis. Frontiers in Immunology. DOI PubMed
- [13] Zhang H, Zhao Y, Jiang X, et al. (2023). Niacinamide enhances cathelicidin mediated SARS-CoV-2 membrane disruption. Frontiers in Immunology. DOI PubMed
- [14] Torossian A, Gurschi E, Bals R, et al. (2007). LL-37 protects rats against lethal sepsis caused by Gram-negative bacteria. Critical Care Medicine. PubMed
- [15] Nagaoka I, Tamura H, Reich J. (2020). Therapeutic potential of cathelicidin peptide LL-37, an antimicrobial agent, in a murine sepsis model. International Journal of Molecular Sciences. DOI PubMed
- [16] Kumagai Y, Murakami T, Nagaoka I. (2020). Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immunity. DOI PubMed
- [17] Hu Z, Zhang L, Wang H, et al. (2024). LL-37 improves sepsis-induced acute lung injury by suppressing pyroptosis in alveolar epithelial cells. International Immunopharmacology. PubMed
- [18] Kusaka S, Nishida A, Takahashi K, et al. (2018). Expression of human cathelicidin peptide LL-37 in inflammatory bowel disease. Clinical and Experimental Immunology. DOI PubMed
- [19] Koppen BC, Mulder PPG, de Boer L, et al. (2019). Antimicrobial peptide LL-37 is bactericidal against Staphylococcus aureus biofilms. PLOS ONE. DOI PubMed
- [20] Dean SN, Bishop BM, van Hoek ML. (2011). Identification of peptides derived from the human antimicrobial peptide LL-37 active against biofilms formed by Pseudomonas aeruginosa. Antimicrobial Agents and Chemotherapy. DOI PubMed
- [21] Cheng M, Ho S, Yoo JH, et al. (2019). Myeloid cell-derived LL-37 promotes lung cancer growth by activating Wnt/β-catenin signaling. Theranostics. DOI
- [22] Yang Y, Wu D, Wang C, et al. (2020). Chitosan hydrogel encapsulated with LL-37 peptide promotes deep tissue injury healing in a mouse model. Military Medical Research. DOI PubMed
- [23] Liu PT, Stenger S, Tang DH, Modlin RL. (2007). Cutting edge: vitamin D-mediated human antimicrobial activity against Mycobacterium tuberculosis is dependent on the induction of cathelicidin. Journal of Immunology. DOI PubMed
- [24] Ganguly D, Chamilos G, Lande R, et al. (2009). Self-RNA-antimicrobial peptide complexes activate human dendritic cells through TLR7 and TLR8. Journal of Experimental Medicine. DOI
- [25] Majewski K, Kozłowska E, Żelechowska P, Brzezińska-Błaszczyk E. (2019). Serum concentrations of antimicrobial peptide cathelicidin LL-37 in patients with bacterial lung infections. Central European Journal of Immunology. PubMed
- [26] Sancho-Vaello E, François P, Bonber EJ, et al. (2020). The structure of the antimicrobial human cathelicidin LL-37 shows oligomerization and channel formation in the presence of membrane mimics. Scientific Reports. DOI
- [27] Ordonez SR, Amarullah IH, Wubbolts RW, et al. (2022). In Vitro Antifungal Activity of LL-37 Analogue Peptides against Candida spp.. Journal of Fungi. DOI PubMed
- [28] Ajish C, Yang S, Kumar SD, et al. (2024). Designing analogs of SAAP-148 with enhanced antimicrobial and anti-LPS activities. International Journal of Molecular Sciences. DOI PubMed
- [29] Bals R, Wang X, Zasloff M, Wilson JM. (1998). The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surface. Proceedings of the National Academy of Sciences. DOI
- [30] Wu WKK, Wang G, Coffelt SB, et al. (2010). Emerging roles of the host defense peptide LL-37 in human cancer and its potential therapeutic applications. International Journal of Cancer.