Amylin (IAPP)

1. Overview

Amylin, also known as islet amyloid polypeptide (IAPP), is a 37-amino acid peptide hormone co-secreted with insulin from the dense-core secretory granules of pancreatic beta cells in response to nutrient intake [1][2]. Discovered independently in 1986-1987 by Westermark and colleagues (who named it IAPP after isolating it from islet amyloid deposits) and Cooper and colleagues (who termed it diabetes-associated peptide, later renamed amylin), it is now recognized as the third major islet hormone alongside insulin and glucagon [1][2][4].

The mature human amylin sequence is KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2. It features a disulfide bond between Cys2 and Cys7 forming a rigid N-terminal loop, and an amidated C-terminus -- both post-translational modifications essential for full biological activity [5]. The peptide is encoded by the IAPP gene on chromosome 12p12.1, which contains three exons and shares promoter elements with the insulin gene, explaining their coordinate regulation by glucose and other beta-cell secretagogues [4][5]. IAPP is processed from an 89-residue precursor (preproIAPP) through a 67-residue intermediate (proIAPP) by prohormone convertases PC1/3 and PC2 within secretory granules.

Amylin circulates at picomolar concentrations (5-20 pM fasting, rising to 15-50 pM postprandially) with a short half-life of approximately 13 minutes [4]. It is degraded primarily by insulin-degrading enzyme (IDE) and neprilysin. In patients with type 1 diabetes, amylin is deficient due to beta-cell destruction. In early type 2 diabetes, amylin levels are elevated (paralleling hyperinsulinemia), but decline as progressive beta-cell failure ensues [4][9].

The clinical significance of amylin extends far beyond its physiological role. Human IAPP is one of the most amyloidogenic peptides known, and its misfolding into toxic oligomers and amyloid fibrils is a hallmark of type 2 diabetes, found in over 90% of patients at autopsy [4]. This dual nature -- essential hormone and pathological amyloid precursor -- makes amylin a uniquely important molecule at the intersection of endocrinology, structural biology, and neurodegeneration research.

Pramlintide (Symlin), a synthetic analog with proline substitutions at positions 25, 28, and 29 (modeled after the non-amyloidogenic rat amylin sequence), was approved by the FDA in 2005 as adjunctive therapy for insulin-treated type 1 and type 2 diabetes [6][7][20]. More recently, cagrilintide, a long-acting acylated amylin analog developed by Novo Nordisk, has demonstrated remarkable efficacy for obesity treatment, achieving over 20% mean weight loss when combined with semaglutide in the landmark REDEFINE trials [15][16].

Molecular Weight

3,903.4 g/mol (human amylin)

Sequence

KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Cys2-Cys7 disulfide bond, amidated C-terminus)

Gene

IAPP, chromosome 12p12.1 (OMIM: 147940)

Half-life

~13 minutes (native amylin); pramlintide ~48 minutes

Receptor

AMY1R, AMY2R, AMY3R (CTR + RAMP1/2/3 heterodimers); signals via cAMP, Ca2+, ERK1/2

Co-secreted With

Insulin, in ~1:100 ratio (amylin:insulin) from pancreatic beta-cell granules

Routes Studied

Subcutaneous injection (pramlintide)

FDA Status

Approved: Pramlintide/Symlin (adjunct to insulin therapy in T1D and T2D, 2005)

WADA Status

Not prohibited

2. Mechanism of Action

Amylin exerts its physiological effects through a family of three amylin receptors (AMY1R, AMY2R, AMY3R), each composed of the calcitonin receptor (CTR), a class B G-protein-coupled receptor, heterodimerized with one of three receptor activity-modifying proteins (RAMP1, RAMP2, or RAMP3) [5][17]. The RAMPs allosterically modulate CTR to increase its affinity for amylin by 10- to 100-fold. These receptors are widely expressed in the brain (particularly the area postrema, nucleus of the solitary tract, hypothalamus, and nucleus accumbens), pancreas, kidney, bone, and vasculature.

Receptor signaling. Amylin receptor activation primarily stimulates Gs-mediated increases in intracellular cyclic AMP (cAMP), but also engages intracellular calcium mobilization, ERK1/2 phosphorylation, and Akt signaling pathways depending on tissue context [17]. Recent research (2024) has revealed that the three AMY receptor subtypes have distinct basal subunit equilibria that are differentially modulated by agonist binding, determining the magnitude of downstream cAMP signaling.

Glucagon suppression. Amylin inhibits postprandial glucagon secretion from pancreatic alpha cells, reducing hepatic glucose output. This effect is glucose-dependent: amylin does not suppress glucagon during hypoglycemia, preserving this critical counter-regulatory response [4][9]. This mechanism accounts for the reduction in postprandial glucose excursions observed with pramlintide therapy.

Gastric emptying. Amylin potently delays gastric emptying through vagal afferent pathways originating in the area postrema. This slows nutrient delivery to the small intestine, blunting postprandial glucose spikes. The effect is physiological in nature and complements the glucose-lowering actions of insulin [4][5].

Satiety and appetite regulation. Peripheral amylin binds primarily to receptors in the area postrema (AP), a circumventricular organ lacking a full blood-brain barrier, allowing circulating amylin direct access to central neurons. The signal propagates to the nucleus of the solitary tract (NTS), lateral parabrachial nucleus (LPBN), and then to forebrain regions including the central amygdala, bed nucleus of the stria terminalis, and hypothalamic nuclei [3][17]. Amylin reduces meal size through a rapid satiation effect and also inhibits hedonic feeding and reward-driven food intake. This central mechanism underlies the weight loss observed with amylin-based therapies.

Leptin sensitization. A particularly important discovery is amylin's ability to restore leptin sensitivity in the obese state. In diet-induced obese rats, amylin pretreatment restores hypothalamic leptin signaling (pSTAT3 immunoreactivity) in the ventromedial nucleus and upregulates leptin signaling in the area postrema [10]. This mechanism explains the synergistic weight loss observed with combined amylin-leptin treatment, which produces fat-specific weight loss without the counter-regulatory metabolic slowing seen with caloric restriction alone.

Bone metabolism. Amylin inhibits osteoclast motility and bone resorption while stimulating osteoblast proliferation. Amylin-knockout mice exhibit bone loss due to uncontrolled resorption, establishing amylin as an anabolic bone hormone [17]. This action is likely mediated through calcitonin receptor-related mechanisms.

Renal effects. At physiological concentrations, amylin stimulates plasma renin activity and increases aldosterone secretion. At higher concentrations, it increases urine flow, sodium excretion, glomerular filtration rate, and renal plasma flow, suggesting a role in electrolyte homeostasis [17].

Cardiovascular effects. Amylin exhibits vasodilating and anti-inflammatory properties, primarily mediated through activation of CGRP receptors in vascular tissue. Given its combined metabolic and renal actions, amylin may serve as a link between glucose intolerance, the renin-angiotensin system, and hypertension.

3. Researched Applications

Type 2 Diabetes -- Glucose Homeostasis (Strong Evidence)

Amylin deficiency is a core feature of diabetes that compounds the effects of insulin deficiency. In healthy physiology, amylin and insulin work in concert: insulin promotes peripheral glucose uptake while amylin controls the rate of glucose appearance in the blood through glucagon suppression and gastric emptying regulation [4][9]. The loss of amylin in type 1 diabetes (complete) and progressive loss in type 2 diabetes (as beta cells fail) contributes to postprandial glucose dysregulation that is inadequately addressed by insulin therapy alone.

Pramlintide clinical trials demonstrated that amylin replacement improves glycemic control beyond what insulin alone achieves. In type 2 diabetes, pramlintide 120 mcg three times daily reduced HbA1c by 0.3-0.6% and postprandial glucose by 3.4-5.0 mmol/L compared to insulin alone [6][7]. In type 1 diabetes, pramlintide 60 mcg reduced postprandial glucose excursions by approximately 4.7 mmol/L [8]. Importantly, these glycemic improvements occurred alongside weight loss rather than the weight gain typically associated with insulin intensification.

Type 2 Diabetes -- IAPP Aggregation and Beta-Cell Pathology (Strong Evidence)

The aggregation of IAPP into toxic oligomers and amyloid fibrils is a defining pathological feature of type 2 diabetes, present in over 90% of patients at autopsy [4][13]. The amyloidogenic region resides primarily in residues 20-29 (SNNFGAILSS), a sequence unique to species that develop islet amyloid (humans, non-human primates, cats) and absent in species resistant to aggregation (rodents, which have three proline substitutions in this region) [5][13].

The aggregation cascade proceeds from monomers through small soluble oligomers (approximately 5-8 mers), protofibrils, and finally mature amyloid fibrils. Current evidence strongly supports that small soluble oligomers, rather than mature fibrils, are the primary toxic species [4][13]. These oligomers damage beta cells through multiple mechanisms: membrane disruption via pore formation, endoplasmic reticulum (ER) stress from intracellular accumulation of misfolded species, mitochondrial dysfunction and reactive oxygen species (ROS) generation, NLRP3 inflammasome activation with IL-1beta release, and defective autophagy [4][13].

IAPP oligomerization levels in plasma correlate with type 2 diabetes duration in insulin-naive patients, supporting the hypothesis that IAPP aggregation drives progressive beta-cell loss and disease progression [13]. This understanding has spurred development of anti-aggregation therapeutics, including a human antibody selectively targeting pathologic IAPP aggregates (not monomers) that protected beta cells and preserved insulin secretion in preclinical models [14].

Obesity and Weight Management (Strong Evidence)

Amylin's potent satiety effects and ability to restore leptin sensitivity have made it a high-value target for obesity pharmacotherapy. The foundational preclinical work demonstrated that combined amylin-leptin treatment in diet-induced obese rats produced synergistic, fat-specific weight reductions of up to 15%, with 2-fold greater fat loss than pair-fed controls and without compensatory decreases in energy expenditure [10].

In a 24-week clinical proof-of-concept study, pramlintide plus recombinant human leptin (metreleptin) produced 12.7% mean weight loss in overweight/obese subjects, significantly exceeding either treatment alone [10]. However, subsequent studies revealed this synergy may be attenuated in individuals with extreme obesity.

Cagrilintide represents the next generation of amylin-based obesity therapy. This long-acting acylated amylin analog enables once-weekly dosing. As monotherapy, cagrilintide demonstrated 11.8% mean weight reduction vs 2.3% with placebo over 68 weeks. The combination of cagrilintide with semaglutide (CagriSema) has produced the most striking results in recent obesity pharmacotherapy:

• REDEFINE 1 (n=3,417): Cagrilintide 2.4 mg + semaglutide 2.4 mg weekly achieved 20.4% mean body weight reduction at 68 weeks vs 3.0% with placebo. Sixty percent of participants lost over 20% body weight, and 23% lost over 30% [15].
• REDEFINE 2 (n=1,206): In adults with type 2 diabetes and overweight/obesity, the combination produced 13.7% mean weight loss vs 3.4% with placebo over 68 weeks, along with significant HbA1c improvements [16].

Gastrointestinal adverse events were reported in 72.5% of the cagrilintide-semaglutide group (vs 34.4% placebo), mostly transient and mild to moderate [15][16].

Alzheimer's Disease and Neurodegeneration (Emerging Evidence)

The relationship between amylin and Alzheimer's disease (AD) is complex and bidirectional, involving both pathological cross-seeding and potential therapeutic neuroprotection [11][12][18][19].

Pathological cross-interaction. Human IAPP and amyloid-beta (Abeta) share striking structural and biochemical similarities: both form beta-sheet-rich amyloid structures, bind to the same receptor (AMY3R), and are degraded by the same protease (IDE) [12]. In vitro studies demonstrate that hIAPP promotes Abeta oligomerization, forming heterocomplexes with distinct amorphous structures and 3-fold increased neuronal toxicity compared to either protein alone [12]. Accumulating evidence describes amylin-Abeta cross-seeding in brains of individuals with sporadic AD [19].

Neuroprotective potential. Paradoxically, physiological amylin signaling may be neuroprotective. A cross-sectional study of 578 older adults found that higher plasma amylin concentrations were associated with reduced AD risk (OR 0.52 per SD increase) and greater hippocampal volume [11]. Mechanistically, amylin enhances Abeta clearance across the blood-brain barrier by inducing LRP1 translocation to the plasma membrane of BBB endothelium [11]. Amylin also modulates neuroinflammation, improves cerebral glucose metabolism, and may promote neuronal survival through cAMP-dependent pathways.

Therapeutic implications. Both amylin receptor agonism and antagonism have shown preclinical benefit in AD models, reflecting the dual nature of amylin signaling in neurodegeneration. Pramlintide (a non-aggregating agonist) improved AD pathology and cognition in mouse models, while the amylin receptor antagonist AC253 also reduced Abeta burden and improved cognition in 5xFAD mice [18]. This apparent paradox may be resolved by the hypothesis that non-aggregating amylin agonism promotes beneficial clearance and signaling, while blocking the pathological activation of AMY3R by Abeta oligomers prevents neurotoxic signaling.

Additionally, a recent discovery (2025) that human amylin exhibits potent antimicrobial activity, synergizing with Abeta against Salmonella Typhimurium and Staphylococcus aureus, has raised intriguing questions about whether both peptides may have evolved as components of innate immune defense, with their amyloidogenic properties serving an antimicrobial function that becomes pathological in aging.

Bone Health (Preclinical/Emerging Evidence)

Amylin's osteoanabolic properties -- inhibiting osteoclast-mediated bone resorption while stimulating osteoblast proliferation -- position it as a potential therapeutic for osteoporosis. Amylin-knockout mice develop bone loss from uncontrolled resorption, and systemic amylin administration in male mice increased bone mass, linear growth, and adiposity [17]. Clinical translation of this finding has not yet been pursued.

4. Clinical Evidence Summary

5. Dosing in Research

Pramlintide (Symlin) -- FDA-approved regimens. In type 2 diabetes, pramlintide is initiated at 60 mcg subcutaneously immediately before each major meal (containing at least 250 kcal or 30 g carbohydrate), with upward titration to 120 mcg per meal after 3-7 days if no clinically significant nausea occurs. In type 1 diabetes, the starting dose is 15 mcg before meals, titrated in 15 mcg increments (30, 45, 60 mcg) every 3 or more days as tolerated, to a maximum of 60 mcg per meal. Critically, mealtime rapid-acting or pre-mixed insulin doses must be reduced by 50% at pramlintide initiation to prevent hypoglycemia, and then individually adjusted based on glucose monitoring [6][7][8][20].

Pramlintide is administered via SymlinPen injection devices: SymlinPen 60 delivers doses of 15, 30, 45, or 60 mcg, while SymlinPen 120 delivers doses of 60 or 120 mcg. The injection is given subcutaneously in the abdomen or thigh, at a site distinct from the concurrent insulin injection.

Cagrilintide. In clinical trials, cagrilintide has been administered as a once-weekly subcutaneous injection. Dose-escalation protocols titrate from 0.3 mg weekly up to a target of 2.4-4.5 mg weekly over 4-16 weeks. In the REDEFINE program, cagrilintide 2.4 mg was co-administered with semaglutide 2.4 mg, both given once weekly [15][16].

6. Safety and Side Effects

Pramlintide (Symlin)

Nausea. The most common adverse event, occurring in approximately 30-50% of patients during initiation but typically transient, resolving within the first 4 weeks of therapy. Gradual dose titration significantly mitigates this effect [6][7][20].

Hypoglycemia. Severe hypoglycemia risk is increased, particularly in type 1 diabetes, primarily during the initial treatment period. This risk is largely preventable with the mandated 50% reduction in mealtime insulin at pramlintide initiation and subsequent careful insulin dose adjustment [8][20]. In type 2 diabetes, the risk of severe hypoglycemia is lower.

Anorexia and reduced appetite. Reported in approximately 10-15% of patients, consistent with amylin's physiological satiety mechanism. This effect contributes to the weight loss benefit but may require monitoring in patients at risk for undernutrition [20].

Injection site reactions. Generally mild and infrequent. Pramlintide must be injected at a separate site from insulin (at least 2 inches apart) and cannot be mixed with insulin in the same syringe due to pH incompatibility.

Contraindications. Pramlintide is contraindicated in patients with gastroparesis, hypoglycemia unawareness, and in those requiring medications that stimulate gastrointestinal motility. It should not be used in patients with poor compliance with insulin monitoring or HbA1c above 9% [20].

Cagrilintide-Semaglutide (CagriSema)

In the REDEFINE trials, gastrointestinal adverse events were the most common side effects, reported in 72.5% of the combination group vs 34.4% of placebo. These were predominantly nausea, vomiting, diarrhea, and constipation -- mostly transient and mild to moderate in severity. Discontinuation rates due to adverse events were higher in the active treatment group but remained manageable [15][16].

IAPP Aggregation Toxicity (Endogenous)

While not a drug side effect per se, the propensity of endogenous human IAPP to aggregate into toxic species is a critical safety consideration in the broader context of amylin biology. This aggregation tendency is why pramlintide (with proline-based aggregation resistance) was developed rather than using native human amylin as a therapeutic. Cagrilintide was similarly engineered with modifications preventing amyloid formation.

7. Structural Biology and Aggregation

Peptide Structure

Human amylin is processed from an 89-amino acid precursor (preproIAPP). The 22-residue signal peptide is cleaved co-translationally, yielding the 67-residue proIAPP, which is subsequently processed by prohormone convertases PC1/3 (N-terminal cleavage) and PC2 (C-terminal cleavage) within beta-cell secretory granules. The mature 37-residue peptide features an intramolecular disulfide bond (Cys2-Cys7) forming a rigid N-terminal loop, and a C-terminal amidation at Tyr37, both required for full biological activity [5].

The three-dimensional structure reveals a U-shaped architecture: residues 1-7 form the disulfide-constrained loop, residues 8-18 form an alpha-helical segment, residues 18-22 form a flexible turn, and residues 23-35 form the C-terminal helix. This amphipathic helical character facilitates membrane interaction, which is physiologically relevant for receptor binding but also underlies the pathological membrane disruption by aggregated species [5][13].

Amyloidogenic Region and Species Differences

The primary amyloidogenic determinant resides in residues 20-29 (SNNFGAILSS in humans). Rat and mouse IAPP contain three proline substitutions in this region (at positions 25, 28, and 29), which act as "beta-sheet breakers," preventing the formation of cross-beta amyloid structures [5][13]. This is the direct basis for the design of pramlintide, which incorporates these same three proline substitutions (Ala25Pro, Ser28Pro, Ser29Pro) into the human sequence, yielding a molecule that retains full amylin receptor agonist activity but is essentially non-amyloidogenic. All three substitutions are required for complete aggregation inhibition; fewer substitutions provide insufficient protection [5].

Aggregation Cascade and Toxicity Mechanisms

The IAPP aggregation pathway proceeds through well-characterized stages: monomers form small soluble oligomers (dimers through approximately octamers), which assemble into larger protofibrils and ultimately mature amyloid fibrils with characteristic cross-beta-sheet structure. The key insight from recent structural biology work is that the small soluble oligomers -- not the end-stage fibrils -- are the primary cytotoxic species [4][13].

These toxic oligomers kill beta cells through multiple converging pathways: (1) Membrane disruption through formation of ion-permeable pores in the lipid bilayer, causing calcium influx and loss of ionic homeostasis; (2) Endoplasmic reticulum stress from intracellular accumulation of misfolded proIAPP intermediates, triggering the unfolded protein response (UPR) and apoptosis; (3) Mitochondrial dysfunction with generation of reactive oxygen species; (4) Activation of the NLRP3 inflammasome, triggering IL-1beta-mediated inflammation; (5) Impairment of the autophagy-lysosomal degradation pathway [4][13].

Evidence suggests IAPP aggregation may also propagate in a prion-like manner, with misfolded IAPP seeds accelerating aggregation in neighboring cells and potentially transmitting pathology across islets [4].

8. Amylin and the Brain -- Diabetes-Alzheimer's Connection

The connection between amylin and Alzheimer's disease represents one of the most active and complex areas of amylin research. Type 2 diabetes is a well-established risk factor for Alzheimer's disease (1.5-2-fold increased risk), and amylin sits at the molecular intersection of these two conditions [11][12][18][19].

Cross-seeding hypothesis. Human IAPP and amyloid-beta peptide share approximately 25% sequence identity, similar beta-sheet propensity, common degradation by IDE, and the ability to bind each other's aggregation-promoting surfaces. Studies have demonstrated that hIAPP promotes Abeta oligomerization and vice versa, forming heterocomplexes with up to 3-fold enhanced neurotoxicity compared to either peptide alone [12]. Post-mortem studies have identified amylin deposits in the brains of AD patients, and circulating amylin correlates with beta-amyloid burden in familial AD [19].

Neuroprotective paradox. Despite the toxic cross-interaction of aggregated forms, physiological monomeric amylin appears neuroprotective. Higher circulating amylin levels are associated with reduced AD risk and preserved hippocampal volume [11]. Mechanistically, amylin enhances Abeta clearance across the blood-brain barrier by inducing LRP1 translocation to the endothelial plasma membrane [11]. Amylin also modulates neuroinflammation, improves cerebral glucose metabolism, and may promote neuronal survival through cAMP-dependent pathways.

Therapeutic implications. Both amylin receptor agonism and antagonism have shown preclinical benefit in AD models, reflecting the dual nature of amylin signaling in neurodegeneration. Pramlintide (a non-aggregating agonist) improved AD pathology and cognition in mouse models, while the amylin receptor antagonist AC253 also reduced Abeta burden and improved cognition in 5xFAD mice [18]. This apparent paradox may be resolved by the hypothesis that non-aggregating amylin agonism promotes beneficial clearance and signaling, while blocking the pathological activation of AMY3R by Abeta oligomers prevents neurotoxic signaling.

Additionally, a recent discovery (2025) that human amylin exhibits potent antimicrobial activity, synergizing with Abeta against Salmonella Typhimurium and Staphylococcus aureus, has raised intriguing questions about whether both peptides may have evolved as components of innate immune defense, with their amyloidogenic properties serving an antimicrobial function that becomes pathological in aging.

9. Regulatory Status

Pramlintide (Symlin). Approved by the U.S. FDA in March 2005 as an adjunct to mealtime insulin therapy in patients with type 1 or type 2 diabetes who have failed to achieve adequate glycemic control with optimal insulin therapy. Available as SymlinPen 60 and SymlinPen 120 prefilled injection pens. Pramlintide has not been widely adopted clinically due to the burden of additional injections, complex insulin dose adjustment requirements, and limited insurance coverage. It remains available but is considered underutilized [20].

Cagrilintide. As of March 2026, cagrilintide is under regulatory review based on the REDEFINE trial program results. The combination of cagrilintide with semaglutide (CagriSema) is anticipated to become a major obesity and type 2 diabetes therapeutic, representing the most potent pharmacological weight loss achieved in clinical trials to date [15][16].

Amycretin. Novo Nordisk's amycretin, a co-agonist that combines GLP-1 receptor and amylin receptor activity within a single molecule, has shown remarkable Phase 2 results: up to 22% weight loss over 36 weeks and HbA1c reductions of up to 1.8% in type 2 diabetes. In June 2025, Novo Nordisk announced the expansion of the amycretin program into Phase 3, with trials for both injectable and oral formulations beginning in early 2026. Amycretin represents a next-generation approach that combines both amylin and GLP-1 pathways in a single peptide rather than a co-formulation.

Petrelintide. Zealand Pharma is developing petrelintide, a potent, stable, long-acting human amylin analogue described in a 2025 Journal of Medicinal Chemistry publication. Petrelintide is currently in Phase 2 clinical development for obesity, with data expected in late 2025 or early 2026.

10. Related Peptides

See also: Pramlintide (Symlin), Cagrilintide, Semaglutide, Tirzepatide

11. References

1. [1] Cooper GJ, Willis AC, Clark A, et al. (1987). Purification and characterization of a peptide from amyloid-rich pancreases of type 2 diabetic patients. Proceedings of the National Academy of Sciences. DOI PubMed
2. [2] Westermark P, Wernstedt C, Wilander E, et al. (1987). Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells. Proceedings of the National Academy of Sciences. DOI PubMed
3. [3] Lutz TA, Del Prete E, Scharrer E. (1995). Reduction of food intake in rats by intraperitoneal injection of low doses of amylin. Physiology & Behavior. DOI PubMed
4. [4] Westermark P, Andersson A, Westermark GT. (2011). Islet amyloid polypeptide, islet amyloid, and diabetes mellitus. Physiological Reviews. DOI PubMed
5. [5] Cao P, Marek P, Noor H, et al. (2013). Islet amyloid polypeptide: structure, function, and pathophysiology. Journal of Diabetes Investigation. DOI PubMed
6. [6] Hollander PA, Levy P, Fineman MS, et al. (2003). Pramlintide as an adjunct to insulin therapy improves long-term glycemic and weight control in patients with type 2 diabetes. Diabetes Care. DOI PubMed
7. [7] Whitehouse F, Kruger DF, Fineman M, et al. (2002). A randomized study and open-label extension evaluating the long-term efficacy of pramlintide as an adjunct to insulin therapy in type 1 diabetes. Diabetes Care. DOI PubMed
8. [8] Ratner RE, Want LL, Fineman MS, et al. (2002). Adjunctive therapy with the amylin analogue pramlintide leads to a combined improvement in glycemic and weight control in insulin-treated subjects with type 2 diabetes. Diabetes Technology & Therapeutics. DOI PubMed
9. [9] Edelman SV, Weyer C. (2002). Unresolved challenges with insulin therapy in type 1 and type 2 diabetes: potential benefit of replacing amylin, a second beta-cell hormone. Diabetes Technology & Therapeutics. DOI PubMed
10. [10] Roth JD, Roland BL, Cole RL, et al. (2008). Leptin responsiveness restored by amylin agonism in diet-induced obesity: evidence from nonclinical and clinical studies. Proceedings of the National Academy of Sciences. DOI PubMed
11. [11] Adler BL, Yarchoan M, Hwang HM, et al. (2019). Association of Plasma Amylin Concentration With Alzheimer Disease and Brain Structure in Older Adults. JAMA Network Open. DOI PubMed
12. [12] Fawver JN, Ghiwot Y, Koola C, et al. (2020). Amylin and beta amyloid proteins interact to form amorphous heterocomplexes with enhanced toxicity in neuronal cells. Scientific Reports. DOI PubMed
13. [13] Singh S, Bhowmick DC, Pany S, et al. (2018). IAPP in type II diabetes: Basic research on structure, molecular interactions, and disease mechanisms suggests potential intervention strategies. Biochimica et Biophysica Acta - Biomembranes. DOI PubMed
14. [14] Poulsen AT, Fortin JS, et al. (2023). A human antibody against pathologic IAPP aggregates protects beta cells in type 2 diabetes models. Nature Communications. DOI PubMed
15. [15] Lau J, Buse JB, et al. (2025). Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity (REDEFINE 1). New England Journal of Medicine. DOI PubMed
16. [16] Frias JP, et al. (2025). Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes (REDEFINE 2). New England Journal of Medicine. DOI PubMed
17. [17] Hay DL, Chen S, Lutz TA, et al. (2015). Amylin: pharmacology, physiology, and clinical potential. Pharmacological Reviews. DOI PubMed
18. [18] Soudy R, Patel A, Fu W, et al. (2017). Cyclic AC253, a novel amylin receptor antagonist, improves cognitive deficits in a mouse model of Alzheimer's disease. Alzheimer's & Dementia: Translational Research & Clinical Interventions. DOI PubMed
19. [19] Ly H, Verma N, Wu F, et al. (2021). The association of circulating amylin with beta-amyloid in familial Alzheimer's disease. Alzheimer's & Dementia: Translational Research & Clinical Interventions. DOI PubMed
20. [20] Ryan GJ, Jobe LJ, Martin R. (2005). Pramlintide in the treatment of type 1 and type 2 diabetes mellitus. Clinical Therapeutics. DOI PubMed