Exendin-4

1. Overview

Exendin-4 is a 39-amino acid peptide amide originally isolated from the salivary venom of the Gila monster lizard (Heloderma suspectum) by Dr. John Eng at the James J. Peters VA Medical Center (formerly Bronx VA Medical Center) in 1992 [1]. With the sequence H-GEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 and a molecular weight of 4186.6 Da, exendin-4 is a potent agonist of the human glucagon-like peptide-1 receptor (GLP-1R) that shares approximately 53% amino acid sequence identity with mammalian GLP-1(7-36)amide [1][3][14].

The discovery of exendin-4 represents one of the most celebrated examples of drug development from animal venom. The peptide is the direct parent compound of exenatide -- the synthetic form of exendin-4 marketed as Byetta (2005, twice-daily) and Bydureon (2012, once-weekly) -- which became the first incretin mimetic approved by the FDA for type 2 diabetes mellitus [6]. Exenatide's clinical success catalyzed the development of the entire GLP-1 receptor agonist drug class, which now includes liraglutide, semaglutide, dulaglutide, and tirzepatide, collectively transforming the treatment of diabetes and obesity.

A critical structural feature distinguishing exendin-4 from native human GLP-1 is the presence of glycine at position 2 (Gly2), replacing the alanine found at the corresponding position in GLP-1. This single substitution confers complete resistance to cleavage by dipeptidyl peptidase-4 (DPP-4), the serine protease that inactivates native GLP-1 within approximately 1.5-2 minutes of secretion by removing the two N-terminal amino acids [14][15]. As a result, exendin-4 has a terminal half-life of approximately 2.4 hours following subcutaneous injection -- dramatically longer than native GLP-1 but shorter than later GLP-1R agonists that employ fatty acid acylation for albumin binding (liraglutide ~13 hours, semaglutide ~165 hours).

Beyond its metabolic applications, exendin-4 has become the most extensively studied GLP-1R agonist for neuroprotective effects, with preclinical data demonstrating efficacy in models of Parkinson's disease, Alzheimer's disease, stroke, and traumatic brain injury [7][8][9][13][17].

Molecular Weight

4186.6 Da

Sequence

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (39 amino acids)

Source

Heloderma suspectum (Gila monster) venom/salivary secretions

GLP-1 Homology

Approximately 53% with human GLP-1(7-36)

DPP-4 Resistance

Gly2 substitution prevents DPP-4 cleavage (vs Ala2 in native GLP-1)

Half-life

Approximately 2.4 hours (subcutaneous) vs 1.5-2 minutes for native GLP-1

Discovery

John Eng, Bronx VA Medical Center, 1992

Approved Derivative

Exenatide (Byetta 2005, Bydureon 2012) -- synthetic exendin-4

Key Antagonist

Exendin-4(9-39) -- reference GLP-1R antagonist

CAS Number

141758-74-9

Regulatory Status

Parent compound; exenatide (synthetic exendin-4) is FDA-approved

2. Discovery and Natural History

2.1 The Gila Monster Connection

The path to exendin-4 began with observations about the unusual feeding biology of Heloderma suspectum, a venomous lizard native to the southwestern United States and northwestern Mexico. Gila monsters consume only 5-10 large meals per year, yet maintain metabolic homeostasis between these infrequent feeding bouts. In the late 1980s, Jean-Pierre Raufman at the NIH began investigating Gila monster venom for bioactive peptides and identified components that stimulated cAMP production in pancreatic acinar cells [2].

Building on this work, Dr. John Eng systematically fractionated Heloderma suspectum venom and in 1992 isolated a novel 39-amino acid peptide he named exendin-4 (the fourth exendin peptide identified, where "exendin" derives from "exocrine" and "endocrine" reflecting the peptide's dual endocrine/exocrine gland effects) [1]. Eng recognized the structural similarity to mammalian GLP-1 and filed a patent in 1993 after the Department of Veterans Affairs initially declined to pursue the discovery.

2.2 From Venom to Medicine

At the 1996 American Diabetes Association meeting, Eng's work attracted the attention of Andrew Young at Amylin Pharmaceuticals, who licensed the patent and initiated clinical development of synthetic exendin-4 under the designation AC2993 (later named exenatide) [6]. The clinical program culminated in FDA approval of Byetta in April 2005. Eng received the Golden Goose Award in 2013 for his discovery.

2.3 Exendin-4(9-39): The Reference Antagonist

The truncated fragment exendin-4(9-39) (also called exendin-(9-39)amide) was identified by Goke et al. (1993) as a competitive antagonist of the GLP-1 receptor [3]. This peptide retains receptor binding but lacks agonist activity, making it the standard pharmacological tool for blocking GLP-1R signaling in research. Exendin-4(9-39) has been used extensively to confirm GLP-1R-mediated effects in preclinical studies and has also been investigated in clinical studies of congenital hyperinsulinism and post-bariatric hypoglycemia.

3. Mechanism of Action

3.1 GLP-1 Receptor Activation

Exendin-4 binds the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor (GPCR), with affinity comparable to native GLP-1 [3][4]. Binding activates the Gs-alpha/adenylyl cyclase/cAMP/PKA signaling cascade in pancreatic beta cells, potentiating glucose-stimulated insulin secretion (GSIS). The glucose-dependence of this insulinotropic effect is a critical safety feature: exendin-4 amplifies insulin secretion only when blood glucose exceeds fasting levels, minimizing hypoglycemia risk [5][14].

3.2 Metabolic Actions

Exendin-4 exerts multiple metabolic effects through GLP-1R activation [5][14][15]:

Insulin secretion. Glucose-dependent potentiation of GSIS through cAMP-mediated enhancement of calcium-dependent exocytosis of insulin granules.

Glucagon suppression. Glucose-dependent inhibition of glucagon secretion from pancreatic alpha cells, reducing hepatic glucose output.

Gastric emptying. Substantial delay of gastric emptying through vagal afferent signaling, attenuating postprandial glucose excursions.

Appetite suppression. Central nervous system GLP-1R activation in the hypothalamic arcuate nucleus and brainstem promotes satiety and reduces food intake, contributing to weight loss.

Beta-cell preservation. In preclinical models, exendin-4 promotes beta-cell proliferation, inhibits beta-cell apoptosis, and may enhance beta-cell neogenesis from ductal precursors [15].

3.3 DPP-4 Resistance

The glycine at position 2 of exendin-4 prevents DPP-4 from cleaving the Gly2-Glu3 peptide bond (DPP-4 requires alanine or proline at position 2 for efficient cleavage). Additionally, the C-terminal nine-amino acid extension (PSSGAPPPS-NH2), absent in native GLP-1, may further stabilize the molecule. Together, these features extend the circulating half-life from approximately 1.5 minutes (GLP-1) to approximately 2.4 hours (exendin-4) [14].

3.4 Neuroprotective Mechanisms

GLP-1 receptors are widely expressed in the central nervous system, including the hippocampus, cortex, substantia nigra, and brainstem [19]. Exendin-4 activates neuroprotective signaling through several pathways [7][8][13][17]:

• PI3K/Akt survival signaling: Phosphorylation of Akt promotes neuronal survival by inactivating pro-apoptotic proteins (Bad, Bax, caspase-9)
• Anti-inflammatory effects: Suppression of microglial activation, reduced TNF-alpha and IL-1beta production, inhibition of MMP-3 expression [18]
• Neurogenesis stimulation: Promotion of neural progenitor cell proliferation in the subventricular zone and differentiation into dopaminergic neurons [8]
• Mitochondrial protection: Maintenance of mitochondrial membrane potential and reduction of oxidative stress markers
• Neurotrophic factor upregulation: Increased BDNF and NGF expression in hippocampal and cortical neurons [12]

4. Pharmacokinetics

4.1 Absorption and Distribution

Subcutaneous absorption. Exendin-4 (as exenatide) is administered subcutaneously, reaching peak plasma concentrations (Cmax) approximately 2.1 hours post-injection. Bioavailability from subcutaneous injection is estimated at 65-75% [14].

Half-life. The terminal half-life of exendin-4 is approximately 2.4 hours after subcutaneous administration, representing a ~60-fold improvement over native GLP-1 (~1.5-2 minutes) but substantially shorter than later GLP-1R agonists [14]:

| GLP-1R Agonist | Half-life | Dosing Frequency | DPP-4 Resistance Mechanism | |---|---|---|---| | Native GLP-1 | ~1.5-2 minutes | N/A (not practical as drug) | None | | Exendin-4 / Exenatide (Byetta) | ~2.4 hours | Twice daily | Gly2 substitution | | Exenatide ER (Bydureon) | ~2.4 hours (sustained release) | Once weekly | Gly2 + microsphere depot | | Liraglutide | ~13 hours | Once daily | C16 fatty acid acylation (albumin binding) | | Semaglutide (SC) | ~165 hours (~7 days) | Once weekly | C18 fatty acid acylation + linker |

Volume of distribution. Apparent volume of distribution is 28.3 L, consistent with extracellular fluid distribution with some tissue binding [14].

CNS penetration. Exendin-4 crosses the blood-brain barrier, with CSF concentrations approximately 2-5% of plasma levels. This limited but measurable CNS penetration underlies its neuroprotective effects in preclinical models. However, the Phase 3 Exenatide-PD3 trial (2025) found that CSF exenatide levels were lower than predicted, potentially explaining the negative efficacy result for Parkinson's disease modification [11].

4.2 Metabolism and Elimination

Renal clearance. Exendin-4 is primarily eliminated by glomerular filtration and proteolytic degradation in the kidney. Creatinine clearance correlates with exenatide clearance, and dose adjustment is required in moderate renal impairment (CrCl 30-50 mL/min). Exenatide is not recommended in severe renal impairment or end-stage renal disease [14].

No hepatic metabolism. Unlike small-molecule drugs, exendin-4 is not metabolized by cytochrome P450 enzymes and does not have hepatic drug-drug interactions.

4.3 Immunogenicity

Due to its xenopeptide origin (53% GLP-1 homology), exenatide elicits anti-drug antibodies (ADA) in 45-64% of patients. Most antibodies are low-titer without clinical significance, but high-titer antibodies (found in ~6% of patients) can reduce drug efficacy. This immunogenicity profile contrasts with human GLP-1 analogs (liraglutide ADA rate under 10%, semaglutide under 3%) and represents a pharmacokinetic disadvantage of the xenopeptide sequence [14].

5. Dose-Response Relationship

5.1 Metabolic Dose-Response (as Exenatide)

Glucose-lowering. In the AMIGO Phase 3 trials, exenatide 10 mcg BID produced greater HbA1c reduction than 5 mcg BID (mean -0.9% vs -0.5%, both on background metformin), establishing a clear dose-response for glycemic control [14].

Weight loss. Dose-dependent: 5 mcg BID produced ~1.6 kg weight loss; 10 mcg BID produced ~2.8 kg weight loss over 30 weeks [14].

Nausea. Also dose-dependent: 44% at 10 mcg vs 36% at 5 mcg, reflecting dose-dependent activation of brainstem GLP-1R [14].

5.2 Neuroprotection Dose-Response (Preclinical)

In rodent models, neuroprotective effects show a clear dose-response relationship [7][8][9]:

| Dose (rodent) | Model | Effect | |---|---|---| | 0.1 microg/kg IP | MPTP Parkinson's model | Partial dopaminergic neuroprotection | | 1 microg/kg IP | MPTP Parkinson's model | Near-complete neuroprotection | | 10 microg/kg IP | MPTP Parkinson's model | Maximal neuroprotection (plateau) | | 10 microg/kg IP | MCAO stroke model | ~50% infarct volume reduction | | 100 nmol/kg SC | Alzheimer's model | Reduced amyloid-beta, improved cognition |

5.3 Clinical Neuroprotection Dose-Response

The discrepancy between the positive Phase 2 and negative Phase 3 Parkinson's trials may reflect a dose-response issue [10][11]:

• Phase 2 (positive): 2 mg once weekly for 48 weeks; 3.5-point MDS-UPDRS advantage
• Phase 3 (negative): Same dose (2 mg once weekly) for 96 weeks; no disease modification

CSF analysis in the Phase 3 trial suggested insufficient brain penetration at the 2 mg weekly dose, raising the possibility that higher doses or CNS-penetrant formulations might be needed for neurological applications [11].

6. Comparative Effectiveness

6.1 Exendin-4/Exenatide vs. Liraglutide

| Parameter | Exenatide (Byetta/Bydureon) | Liraglutide (Victoza/Saxenda) | |---|---|---| | Source | Gila monster venom (xenopeptide) | Modified human GLP-1 (97% homology) | | Half-life | ~2.4 hours | ~13 hours | | Dosing | 5-10 mcg BID or 2 mg weekly | 1.2-1.8 mg once daily | | HbA1c reduction | -0.8 to -1.0% | -1.0 to -1.5% | | Weight loss | -2.8 kg (30 weeks) | -3.2 kg (30 weeks) | | Immunogenicity | 45-64% ADA | Under 10% ADA | | Nausea rate | 34-44% | 28-40% | | CV outcomes | Neutral (EXSCEL) | MACE reduction (LEADER) | | Neuroprotection data | Phase 2 positive, Phase 3 negative (PD) | Phase 2 ongoing (PD, AD) |

Liraglutide's longer half-life, lower immunogenicity, and demonstrated cardiovascular benefit have made it commercially dominant over exenatide for diabetes, though exenatide retains a niche as the once-weekly Bydureon formulation [14].

6.2 Exendin-4/Exenatide vs. Semaglutide

| Parameter | Exenatide | Semaglutide (Ozempic/Wegovy) | |---|---|---| | Half-life | ~2.4 hours | ~165 hours (~7 days) | | Dosing | BID or weekly | Once weekly (SC) or daily (oral) | | HbA1c reduction | -0.8 to -1.0% | -1.5 to -1.8% | | Weight loss | -2.8 kg (30 weeks) | -5 to -15 kg (dose-dependent) | | CV outcomes | Neutral | MACE reduction (SUSTAIN-6, SELECT) | | Neuroprotection | Most preclinical data | Phase 3 trials ongoing (PD, AD, obesity-related CNS) | | Oral formulation | No | Yes (Rybelsus) |

Semaglutide represents the current pinnacle of GLP-1R agonist pharmacology, with superior efficacy, longer duration, and demonstrated cardiovascular and weight-loss benefits. However, exendin-4 retains historical significance as the founding compound and has the most extensive neuroprotection literature [14].

6.3 Exendin-4 Neuroprotection vs. Other Approaches

| Agent | Mechanism | PD Clinical Data | AD Clinical Data | |---|---|---|---| | Exendin-4/Exenatide | GLP-1R agonism | Phase 2 positive, Phase 3 negative | Preclinical only | | Liraglutide | GLP-1R agonism | Phase 2 ongoing | Phase 2 ongoing (Elad trial) | | Semaglutide | GLP-1R agonism | Phase 3 recruiting | Phase 3 recruiting | | Levodopa/carbidopa | Dopamine replacement | Standard of care (symptomatic) | N/A | | MAO-B inhibitors | Dopamine preservation | Modest neuroprotection signal | N/A |

The failure of the exenatide Phase 3 PD trial does not necessarily invalidate the GLP-1R agonism neuroprotection hypothesis -- it may reflect pharmacokinetic limitations (insufficient CNS penetration) rather than target failure. Semaglutide, with its longer half-life and potentially better CNS exposure, is currently being tested in multiple neurodegenerative disease trials [11].

7. Researched Applications

Type 2 Diabetes (Approved as Exenatide)

The clinical development of synthetic exendin-4 (exenatide) for type 2 diabetes is detailed in the exenatide article. Key milestones include the Phase 2 proof-of-concept study by Kolterman et al. (2003), three pivotal Phase 3 AMIGO trials establishing BID dosing, the DURATION program (1-8) establishing once-weekly dosing, and the EXSCEL cardiovascular outcomes trial (n=14,752) demonstrating cardiovascular safety with a trend toward MACE reduction [5].

Parkinson's Disease (Phase 2 Positive, Phase 3 Negative)

Exendin-4/exenatide has been the most extensively studied GLP-1R agonist for Parkinson's disease neuroprotection.

Preclinical evidence. Li et al. (2009) demonstrated that exendin-4 protected dopaminergic neurons against 6-OHDA and MPTP toxicity in rodent models, preserving striatal dopamine levels and improving motor function through GLP-1R/PI3K/Akt signaling [7]. Bertilsson et al. (2008) showed that exendin-4 stimulated subventricular zone neurogenesis and promoted differentiation of neural progenitors into dopaminergic neurons [8]. Kim et al. (2009) demonstrated neuroprotection via inhibition of microglial activation and MMP-3 [18]. Harkavyi et al. (2008) showed reversal of key deficits in distinct PD rodent models [20].

Phase 2 clinical trial. Athauda et al. (2017) conducted a single-center, double-blind, placebo-controlled trial in 62 patients with moderate Parkinson's disease [10]. Exenatide 2 mg once weekly for 48 weeks showed a significant 3.5-point advantage on MDS-UPDRS Part 3 off-medication motor scores versus placebo, sustained at 60 weeks (12 weeks after stopping treatment; p=0.0318). The persistence of benefit post-washout raised hopes of disease modification.

Phase 3 clinical trial. The larger Exenatide-PD3 Phase 3 trial (2025) randomized 194 patients across six UK hospitals to exenatide 2 mg weekly or placebo for 96 weeks [11]. The trial found no evidence that exenatide modified disease progression. CSF analysis suggested limited brain penetration at the dose used, potentially explaining the negative result. Whether higher doses, alternative formulations, or GLP-1R agonists with better CNS penetration (such as semaglutide) might yield different outcomes remains under investigation.

Alzheimer's Disease (Preclinical Evidence)

Perry et al. and others have demonstrated that exendin-4 reduces brain amyloid-beta levels and plaque burden in APP/PS1 transgenic mice, improves cognitive performance, and enhances hippocampal LTP [12][13][17]. The mechanisms include promotion of neuronal survival via Akt, reduction of neuroinflammation, and enhancement of insulin signaling in the brain (addressing the concept of "type 3 diabetes" or brain insulin resistance in AD).

Stroke (Preclinical Evidence)

Teramoto et al. (2011) demonstrated that exendin-4 administered after MCAO in mice reduced infarct volume by approximately 50%, decreased neurological deficit scores, and suppressed oxidative stress [9]. The neuroprotective effect was GLP-1R-dependent, as it was blocked by co-administration of exendin-4(9-39). Li et al. (2009) also showed neuroprotection in a cortical stroke model [7].

Cardiovascular Protection (Preclinical Evidence)

Exendin-4 has demonstrated cardioprotective effects in preclinical models, including reduction of ischemia-reperfusion injury, improvement of cardiac function in heart failure models, and anti-atherogenic effects through reduction of endothelial inflammation and macrophage activation [16]. These effects are consistent with the cardiovascular safety signal observed in the EXSCEL trial.

8. Clinical Evidence Summary

9. Dosing in Research

As a research peptide (native exendin-4), doses of 0.1-10 microg/kg intraperitoneally or subcutaneously have been used in rodent neuroprotection studies, with treatment durations of 7-28 days. In metabolic studies, doses of 10-250 pmol/kg have been used in diabetic mouse models [5].

As the approved drug exenatide: Byetta is dosed at 5-10 mcg subcutaneous BID; Bydureon at 2 mg subcutaneous once weekly. For Parkinson's disease trials, Bydureon 2 mg weekly was used for 48-96 weeks [10][11].

10. Safety Profile

The safety profile of exendin-4 (as exenatide) has been characterized across millions of patient-years of clinical exposure. The most common adverse effects are gastrointestinal (nausea 34-44%, vomiting 13-18%) which attenuate over weeks. Pancreatitis has been reported rarely, with the EXSCEL trial showing no excess risk (0.4% in both treatment and placebo groups). A boxed warning for thyroid C-cell tumors is based on rodent data, though human relevance is uncertain [14].

Due to its xenopeptide origin (53% GLP-1 homology), exenatide elicits anti-drug antibodies in 45-64% of patients, though most are low-titer without clinical impact. This higher immunogenicity compared to human GLP-1 analogs (liraglutide under 10%, semaglutide under 3%) reflects the structural divergence of the Gila monster peptide from human GLP-1.

The neuroprotection studies have shown an excellent safety profile with no CNS-specific adverse effects in either the Phase 2 or Phase 3 Parkinson's trials [10][11].

Enhanced Safety Considerations

Pancreatitis and pancreatic cancer. Post-marketing reports raised concerns about pancreatitis and pancreatic cancer risk with GLP-1R agonists. The EXSCEL trial (14,752 patients) found pancreatitis rates of 0.4% in both exenatide and placebo groups, providing strong evidence against a causal relationship. Pancreatic cancer rates were also comparable (0.5% vs 0.4%). Nonetheless, exenatide should not be used in patients with a history of pancreatitis, and unexplained persistent abdominal pain should prompt evaluation [14].

Thyroid C-cell tumors. Rodent studies with exenatide and other GLP-1R agonists showed dose-dependent increases in thyroid C-cell hyperplasia and medullary thyroid carcinoma (MTC). This appears to be a rodent-specific effect related to high GLP-1R density on rodent thyroid C-cells; human thyroid C-cells express minimal GLP-1R. Nevertheless, exenatide carries a boxed warning and is contraindicated in patients with personal or family history of MTC or MEN2 [14].

Renal effects. Post-marketing cases of acute kidney injury have been reported, likely related to dehydration from GI side effects (nausea, vomiting, diarrhea). Exenatide should be used with caution in patients with renal impairment and is contraindicated in severe renal failure (CrCl under 30 mL/min) [14].

Injection site reactions. Bydureon (once-weekly microsphere formulation) is associated with injection site nodules in approximately 10% of patients, which resolve over weeks. Byetta has lower injection site reaction rates [14].

Hypoglycemia. When used alone, exenatide has minimal hypoglycemia risk due to the glucose-dependent mechanism. However, when combined with sulfonylureas or insulin, hypoglycemia risk increases substantially, and dose reduction of the concomitant agent is recommended [14].

Drug interactions. Delayed gastric emptying can affect absorption of concomitant oral medications. Drugs requiring rapid GI absorption or with narrow therapeutic indices should be taken at least 1 hour before exenatide injection [14].

11. Structural Comparison with Human GLP-1

Exendin-4 and human GLP-1(7-36)amide share 53% sequence identity with key structural differences that explain exendin-4's pharmacological advantages:

• Position 2: Gly (exendin-4) vs Ala (GLP-1) -- confers DPP-4 resistance
• C-terminal extension: The 9-residue PSSGAPPPS-NH2 tail has no GLP-1 counterpart and may enhance stability
• Helical core: Both peptides form amphipathic alpha-helices in the receptor-binding region (approximately residues 7-30), with conserved residues at receptor contact positions explaining comparable binding affinity
• Receptor binding mode: X-ray crystallography and cryo-EM studies show that exendin-4 engages both the N-terminal extracellular domain and the transmembrane domain of GLP-1R, similar to GLP-1 but with distinct contact residues at the C-terminal extension

This structure-function relationship has informed the design of subsequent GLP-1R agonists: liraglutide and semaglutide modified human GLP-1 with fatty acid acylation for albumin binding (greater than 94% GLP-1 homology, lower immunogenicity), while exenatide retained the native xenopeptide sequence.

12. Related Peptides

See also: Exenatide (Byetta / Bydureon), Liraglutide (Victoza / Saxenda), Semaglutide (Ozempic / Wegovy), Tirzepatide (Mounjaro / Zepbound), Glucagon

13. References

1. [1] Eng J. (1992). Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. Journal of Biological Chemistry. DOI PubMed
2. [2] Raufman JP, Singh L, Singh G, Eng J. (1992). Truncated glucagon-like peptide-1 interacts with exendin receptors on dispersed acini from guinea pig pancreas. Journal of Biological Chemistry. PubMed
3. [3] Goke R, Fehmann HC, Linn T, et al. (1993). Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting beta-cells. Journal of Biological Chemistry. PubMed
4. [4] Thorens B, Porret A, Buhler L, et al. (1993). Cloning and functional expression of the human islet GLP-1 receptor. Diabetes. PubMed
5. [5] Young AA, Gedulin BR, Bhavsar S, et al. (1999). Glucose-lowering and insulin-sensitizing actions of exendin-4. Diabetes. PubMed
6. [6] Yap MKK, Misuan N. (2019). Exendin-4 from Heloderma suspectum venom: from discovery to its latest application as type II diabetes combatant. Basic and Clinical Pharmacology and Toxicology. DOI PubMed
7. [7] Li Y, Perry T, Bhatt J, et al. (2009). GLP-1 receptor stimulation preserves primary cortical and dopaminergic neurons in cellular and rodent models of stroke and Parkinsonism. Proceedings of the National Academy of Sciences. DOI PubMed
8. [8] Bertilsson G, Patrone C, Bhatt O, et al. (2008). Peptide hormone exendin-4 stimulates subventricular zone neurogenesis in the adult rodent brain and induces recovery in an animal model of Parkinson's disease. Journal of Neuroscience Research. DOI PubMed
9. [9] Teramoto S, Miyamoto N, Yatomi K, et al. (2011). Exendin-4, a glucagon-like peptide-1 receptor agonist, provides neuroprotection in mice transient focal cerebral ischemia. Journal of Cerebral Blood Flow and Metabolism. DOI PubMed
10. [10] Athauda D, Maclagan K, Skene SS, et al. (2017). Exenatide once weekly versus placebo in Parkinson's disease: a randomised, double-blind, placebo-controlled trial. Lancet. DOI PubMed
11. [11] Athauda D, Maclagan K, Budnik N, et al. (2025). Exenatide once a week versus placebo as a potential disease-modifying treatment for people with Parkinson's disease (Exenatide-PD3). Lancet. DOI PubMed
12. [12] Perry T, Lahiri DK, Chen D, et al. (2002). A novel neurotrophic property of glucagon-like peptide 1: a promoter of nerve growth factor-mediated differentiation in PC12 cells. Journal of Pharmacology and Experimental Therapeutics. DOI PubMed
13. [13] Holscher C. (2010). The role of GLP-1 in neuronal activity and neurodegeneration. Vitamins and Hormones. DOI PubMed
14. [14] Nauck MA, Meier JJ. (2018). Incretin hormones: their role in health and disease. Diabetes, Obesity and Metabolism. DOI PubMed
15. [15] Drucker DJ. (2006). The biology of incretin hormones. Cell Metabolism. DOI PubMed
16. [16] Chen S, Liu AR, Chen M, et al. (2014). Exendin-4 inhibits structural remodeling and improves Ca2+ homeostasis in rats with heart failure via the GLP-1 receptor through the eNOS/cGMP/PKG pathway. Peptides.
17. [17] Greig NH, Mattson MP, Perry T, et al. (2004). New therapeutic strategies and drug candidates for neurodegenerative diseases: p53 and TNF-alpha inhibitors, and GLP-1 receptor agonists. Annals of the New York Academy of Sciences. PubMed
18. [18] Kim S, Moon M, Park S. (2009). Exendin-4 protects dopaminergic neurons by inhibition of microglial activation and matrix metalloproteinase-3 expression in an animal model of Parkinson's disease. Journal of Endocrinology. PubMed
19. [19] Hamilton A, Holscher C. (2009). Receptors for the incretin glucagon-like peptide-1 are expressed on neurons in the central nervous system. Neuroreport. PubMed
20. [20] Harkavyi A, Abuirmeileh A, Lever R, et al. (2008). Glucagon-like peptide 1 receptor stimulation reverses key deficits in distinct rodent models of Parkinson's disease. Journal of Neuroinflammation. DOI PubMed