GLP-1 (Glucagon-Like Peptide 1)

1. Overview

Glucagon-like peptide 1 (GLP-1) is an endogenous incretin hormone of 30 or 31 amino acids, secreted principally from the intestinal enteroendocrine L-cells in response to luminal nutrients. The two biologically active circulating forms are GLP-1 (7-36) amide and GLP-1 (7-37); the amidated 7-36 form predominates in humans and accounts for the majority of circulating bioactivity [1][10]. Both forms arise from tissue-specific post-translational cleavage of the single proglucagon gene (GCG, chromosome 2q24.2) by prohormone convertase 1/3 (PC1/3) in L-cells and in a subset of brainstem neurons, whereas pancreatic alpha cells use PC2 to cleave the same precursor into glucagon [10][16].

GLP-1 was first identified in the early 1980s when the proglucagon gene was cloned from anglerfish and mammals, revealing that it encoded two glucagon-like sequences (GLP-1 and GLP-2) in addition to glucagon itself. The insulinotropic activity of a shortened form, GLP-1 (7-36), was demonstrated by Mojsov, Habener and colleagues in 1987, and Kreymann, Bloom and colleagues confirmed in the same year that infusion of GLP-1 (7-36) amide in humans at post-meal plasma concentrations potently augmented insulin secretion and lowered glucose — establishing GLP-1 as a physiological incretin [1][10].

The clinical significance of GLP-1 cannot be overstated. Nauck's demonstration that the incretin effect is severely blunted in type 2 diabetes [2], coupled with the subsequent finding that GLP-1 (but not GIP) retains insulinotropic activity in diabetic beta cells [3], identified the GLP-1 receptor as a uniquely actionable therapeutic target. Because native GLP-1 has a plasma half-life of only 1 to 2 minutes — rapidly inactivated by the serine protease dipeptidyl peptidase-4 (DPP-4) [4][22] — it is not itself a practical drug. This pharmacokinetic limitation drove two parallel strategies: DPP-4 resistant peptide analogs (exenatide, liraglutide, semaglutide, dulaglutide, lixisenatide) and small-molecule DPP-4 inhibitors (sitagliptin, vildagliptin, linagliptin, saxagliptin). More recently, dual GIP/GLP-1R co-agonists (tirzepatide) and emerging triple agonists (retatrutide) engage the GLP-1R as part of multi-receptor pharmacology [21][23][24].

Molecular Weight

3297.7 Da (GLP-1 7-36 amide); 3355.7 Da (GLP-1 7-37)

Sequence (GLP-1 7-36 amide)

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂

Gene / Precursor

GCG (proglucagon) on chromosome 2q24.2; processed by PC1/3 in L-cells

Receptor

GLP-1R (class B secretin-family GPCR, primarily Gαs-coupled → cAMP; chromosome 6p21.2)

Half-life (intact)

~1-2 minutes (rapidly cleaved by DPP-4 at position 8-9)

Primary source

Intestinal L-cells (ileum, colon); also NTS neurons in brainstem, and pancreatic alpha cells under stress

Physiological role

Incretin: amplifies glucose-stimulated insulin secretion, suppresses glucagon, slows gastric emptying, promotes satiety

Clinical significance

Template for liraglutide, semaglutide, dulaglutide, exenatide, lixisenatide; dual/tri-agonists tirzepatide and retatrutide; DPP-4 inhibitor target

Discovery

Cloned from anglerfish proglucagon (Lund et al., 1982); insulinotropic action in humans (Kreymann et al., 1987)

2. Gene, Precursor, and Tissue-Specific Processing

The Proglucagon Gene

GLP-1 is derived from the proglucagon gene (GCG), a 10 kb transcription unit on chromosome 2q24.2 that encodes a single 180-amino-acid proglucagon precursor [10][16]. Despite expression in three distinct tissues — pancreatic alpha cells, intestinal L-cells, and a small population of brainstem neurons — the mature proglucagon mRNA is identical in all three. Tissue-specific biological products arise not from alternative splicing but from differential expression of prohormone convertases.

Processing in the L-cell (intestine) and NTS (brainstem)

In intestinal L-cells and in preproglucagon-expressing neurons of the nucleus of the solitary tract (NTS), prohormone convertase 1/3 (PC1/3, encoded by PCSK1) is the predominant processing enzyme. PC1/3 cleaves proglucagon at paired basic residues to yield:

• Glicentin-related pancreatic polypeptide (GRPP)
• Glicentin / oxyntomodulin (which itself can be further processed)
• GLP-1 (corresponding to proglucagon residues 78-107 for GLP-1 (7-36) amide, or 78-108 for GLP-1 (7-37))
• Intervening peptide-2 (IP-2)
• GLP-2

Approximately 80% of secreted GLP-1 is amidated (GLP-1 (7-36) NH₂), reflecting the action of peptidylglycine alpha-amidating monooxygenase on the C-terminal glycine residue of the 7-37 intermediate [10][16].

Processing in the Pancreatic Alpha Cell

In pancreatic alpha cells, prohormone convertase 2 (PC2, encoded by PCSK2) predominates and cleaves proglucagon at different basic-residue sites to yield glucagon (residues 33-61), along with GRPP, the major proglucagon fragment (MPGF, containing the unprocessed GLP-1 and GLP-2 sequences), and other fragments. Under normal conditions alpha cells therefore secrete little mature GLP-1. However, under conditions of alpha-cell stress or after beta-cell injury, alpha cells can upregulate PC1/3 expression and generate bioactive GLP-1 locally within the islet, potentially providing a paracrine incretin signal to beta cells [10][13].

3. Secretion and Stimuli

L-cell Distribution

L-cells are scattered throughout the gut epithelium but their density increases distally, with the highest concentrations found in the ileum and proximal colon [10][12]. They are classified as "open type" enteroendocrine cells with an apical microvillus-lined surface that contacts the intestinal lumen, placing nutrient-sensing machinery in direct contact with ingested meal constituents.

Nutrient Stimuli

GLP-1 is secreted biphasically in response to a meal:

• An early phase (within 10-15 minutes of ingestion) mediated by neural and endocrine signaling (vagal efferents, GIP from duodenal K-cells), since direct nutrient contact with distal L-cells would take much longer than the observed rise.
• A later phase (30-60 minutes post-meal) reflecting direct luminal nutrient sensing by L-cells as chyme reaches the distal gut [10].

The principal nutrient secretagogues include: glucose (sensed via SGLT1 and KATP-mediated depolarization), long-chain free fatty acids (sensed via GPR120/FFAR4 and GPR40/FFAR1), monoacylglycerols (via GPR119), short-chain fatty acids generated by microbial fermentation (via GPR41/FFAR3 and GPR43/FFAR2), and amino acids, particularly phenylalanine, tryptophan, glutamine, and leucine (partly via the calcium-sensing receptor CaSR and peptide transporters) [10][12][20].

Fasting vs Postprandial Levels

Fasting plasma levels of intact biologically active GLP-1 are low (5-10 pmol/L in healthy humans), rising to 15-50 pmol/L after a mixed meal. These are approximate values and depend heavily on the assay: total GLP-1 (active + inactive metabolites) may be several-fold higher. The very short plasma half-life means intact GLP-1 levels fall rapidly as secretion wanes [10][17][22].

4. The GLP-1 Receptor (GLP-1R)

Gene and Structure

The GLP-1 receptor is encoded by GLP1R on chromosome 6p21.2. It is a 463-amino-acid class B1 (secretin-like) G-protein coupled receptor (GPCR) with the canonical seven transmembrane helix architecture, a large extracellular N-terminal domain (ECD, ~130 residues) that provides the primary peptide-binding surface, and an intracellular C-terminus involved in desensitization and trafficking [11][13].

Activation Mechanism (from cryo-EM)

Near-atomic cryo-electron microscopy structures solved by Zhang and colleagues in 2017 and subsequent groups revealed the structural basis of GLP-1R activation [11]:

• The C-terminal helical region of GLP-1 docks in the hydrophobic groove of the ECD.
• The N-terminus of GLP-1 (beginning with His7) penetrates deeply into the transmembrane bundle, engaging residues on TM1, TM2, TM3, TM5, TM6, and TM7.
• This ligand binding induces a sharp outward kink in the intracellular half of transmembrane helix 6 (TM6), which — together with rearrangements of TM5 — opens a cytoplasmic cavity for docking of the alpha-5 helix of the stimulatory Gαs subunit.
• Coupling to Gαs leads to dissociation of the heterotrimeric Gs complex and activation of adenylyl cyclase, raising intracellular cAMP.

Signaling Pathways

Primary signaling is through Gαs → adenylyl cyclase → cAMP, which then branches through two main effectors [13][14]:

• Protein kinase A (PKA) — phosphorylates KATP channel subunits, voltage-gated Ca2+ channels, IP3 receptors, the ryanodine receptor, and transcription factors (CREB).
• Epac2 (exchange protein directly activated by cAMP 2 / RAPGEF4) — a guanine nucleotide exchange factor for the small GTPase Rap1, mediating many of the acute effects of GLP-1 on insulin granule priming and exocytosis that are independent of PKA phosphorylation.

Biased signaling is also well documented: some ligands (e.g., exendin-P5) preferentially recruit beta-arrestin over Gαs, with distinct functional consequences for sustained insulin secretion vs receptor internalization. GLP-1R can also couple weakly to Gαq/11, producing smaller phospholipase C-mediated effects [11][13].

Receptor Distribution

GLP-1R is expressed on pancreatic beta cells, alpha cells (lower density), gastric chief cells and smooth muscle, cardiac atrium and ventricle (species-dependent), vascular endothelium, renal tubular and juxtaglomerular cells, rodent thyroid C-cells (high density; much lower in humans), and multiple brain regions including the area postrema, nucleus of the solitary tract (NTS), arcuate nucleus (ARC), paraventricular nucleus (PVN), subfornical organ, hippocampus, and lateral septum [6][10][13][15].

5. Degradation and Clearance

DPP-4 Cleavage

Dipeptidyl peptidase-4 (DPP-4, CD26) is a ubiquitously expressed serine protease found both as a type II transmembrane enzyme and as a soluble plasma form. DPP-4 cleaves peptides containing proline or alanine at the penultimate N-terminal position — a motif present in GLP-1 at the Ala8-Glu9 bond. Cleavage removes the N-terminal His-Ala dipeptide, generating GLP-1 (9-36) amide, which has dramatically reduced GLP-1R agonist activity and may even act as a weak antagonist or exert distinct cardiovascular effects [4][22].

Deacon and Holst demonstrated that DPP-4 cleavage of GLP-1 begins within the hepatic portal circulation immediately after secretion, such that fewer than 25% of L-cell-secreted GLP-1 molecules reach the systemic circulation intact. The in vitro plasma half-life of GLP-1 (7-36) amide at 37°C is approximately 20 minutes; the in vivo plasma half-life (inclusive of renal clearance) is only 1 to 2 minutes [4][22].

Renal Clearance and NEP

GLP-1 (7-36) amide and its DPP-4 metabolite are cleared renally by both filtration and tubular secretion. Neutral endopeptidase (NEP, neprilysin) provides additional peptide cleavage, further limiting the bioactive half-life [10][22].

Therapeutic Implications

The very short half-life of native GLP-1 explains why GLP-1 itself is not a viable drug. Every approved GLP-1R agonist incorporates one or more of the following modifications to confer DPP-4 resistance and extend half-life:

• Substitution at position 8 (e.g., Aib8 in semaglutide; Gly8 in exenatide and liraglutide reduces DPP-4 cleavage compared to native Ala8) [24]
• Albumin binding via fatty acid conjugation (liraglutide: C16 palmitate; semaglutide: C18 diacid linker) [24]
• Fc fusion (dulaglutide)
• Use of exendin-4 backbone — the exendin peptide from Heloderma suspectum has Gly at position 2 and is naturally DPP-4 resistant, forming the basis of exenatide and lixisenatide

6. Pancreatic Actions

Glucose-Dependent Insulin Secretion

The hallmark pancreatic action of GLP-1 is glucose-dependent potentiation of insulin secretion [3][10][13][14]. In isolated beta cells and intact pancreas, GLP-1 has minimal effect at low glucose concentrations (less than 4-5 mmol/L) but produces several-fold amplification of glucose-stimulated insulin secretion at elevated glucose levels. This glucose-dependence is a central feature that explains the low intrinsic hypoglycemia risk of GLP-1R agonist monotherapy.

The mechanistic cascade at the beta cell [14]:

1. GLP-1R activation raises intracellular cAMP.
2. cAMP activates PKA and Epac2.
3. PKA phosphorylates and closes ATP-sensitive potassium (KATP) channels, augmenting the depolarization produced by glucose-derived ATP.
4. Membrane depolarization opens voltage-gated Ca2+ channels; Epac2 and PKA further sensitize these channels.
5. Rising cytosolic Ca2+ triggers insulin granule exocytosis.
6. Epac2/Rap1 and PKA prime the "readily releasable pool" of insulin granules, increasing the number of granules available for rapid exocytosis.
7. Sensitization of IP3 receptors and ryanodine receptors amplifies Ca2+-induced Ca2+ release (CICR) from ER stores, prolonging the Ca2+ signal.

Crucially, the KATP-channel closure and granule-priming effects require a permissive glucose signal to produce secretion — so the cascade is strongly potentiating only when glucose is already elevated.

Glucagon Suppression

GLP-1 suppresses glucagon secretion from pancreatic alpha cells in a glucose-dependent manner. The suppression is largely indirect, mediated by paracrine signals from beta cells (insulin and zinc) and delta cells (somatostatin), although direct alpha-cell GLP-1R effects have been described [10][13].

Beta-Cell Mass and Survival

In rodent models, chronic GLP-1R agonism increases beta-cell proliferation and reduces beta-cell apoptosis, expanding functional beta-cell mass [13]. Whether these effects translate to humans in clinically meaningful ways remains uncertain: glucose-lowering effects in patients are reversible upon discontinuation, and no unambiguous increase in human beta-cell mass has been documented.

7. Central Nervous System Actions

Central GLP-1R Distribution

GLP-1 acts centrally through at least two populations of GLP-1R: those expressed on vagal afferent terminals (accessed by peripheral GLP-1 before it is cleaved by DPP-4) and those expressed on CNS neurons [6][12][13]. Endogenous brain GLP-1 is produced by a small population of NTS neurons whose axons project widely, including to the hypothalamic arcuate (ARC) and paraventricular (PVN) nuclei, the lateral hypothalamus, the bed nucleus of the stria terminalis, and midbrain reward regions.

Appetite and Food Intake

Turton and colleagues (1996) demonstrated in Nature that intracerebroventricular GLP-1 administration produced profound, dose-dependent suppression of food intake in rats, and that a GLP-1R antagonist (exendin 9-39) blocked this effect and also partially blocked the anorectic action of leptin — the first clear evidence of central GLP-1 control of feeding [6]. Subsequent work identified the specific circuits involved: GLP-1 activates POMC/CART neurons in the arcuate nucleus and inhibits (indirectly via GABAergic interneurons) NPY/AgRP neurons, shifting the balance of hypothalamic output toward satiety [6][13].

In humans, peripheral GLP-1 infusion reliably reduces subjective hunger, increases fullness, and reduces ad libitum energy intake by approximately 12-15% at a subsequent meal [7]. Part of this effect is mediated by vagal afferents and part by direct CNS action at circumventricular sites (area postrema, subfornical organ) that lack a complete blood-brain barrier [6][12].

Reward and Motivation

GLP-1R is expressed in the ventral tegmental area and nucleus accumbens, and GLP-1R agonism reduces motivational and hedonic responses to palatable food, alcohol, and some addictive drugs in animal models [13][20]. These findings have motivated investigation of GLP-1R agonists in alcohol use disorder and other substance use conditions.

Nausea and Emesis

A well-known side effect of pharmacological GLP-1R agonism is nausea, mediated at least in part by GLP-1R in the area postrema and NTS — classical brainstem "chemoreceptor trigger zone" regions. Gastric distension (from slowed gastric emptying) and delayed gut transit may also contribute.

8. Gastrointestinal Actions

Delayed Gastric Emptying

GLP-1 slows gastric emptying via vagally mediated pathways [7][10]. This is a major contributor to its blood glucose-lowering effect in the postprandial state because it blunts the rate of glucose appearance. It also contributes to satiety by prolonging gastric distension. The effect is dose-dependent and, for some long-acting analogs, may attenuate with chronic use as tachyphylaxis develops at the gastrointestinal level.

Gastric Acid Secretion

GLP-1 inhibits pentagastrin- and meal-stimulated gastric acid secretion in humans in a vagus-dependent manner [10]. The clinical importance of this effect is limited relative to the glycemic and appetite actions.

9. Cardiovascular and Renal Actions

Direct Cardiovascular Effects

Low-level GLP-1R expression has been documented in the sinoatrial node, atrial cardiomyocytes, ventricular cardiomyocytes (species-dependent), coronary endothelium, and vascular smooth muscle [15]. Direct effects include modest positive chronotropy (1-4 bpm heart rate rise with GLP-1R agonists), endothelial nitric oxide-mediated vasodilation, natriuresis, and anti-inflammatory effects on vascular and cardiac tissue.

Clinical Translation

The LEADER trial (liraglutide, n=9340) demonstrated a 13% reduction in major adverse cardiovascular events (MACE) in T2D patients at high cardiovascular risk [19]. SUSTAIN-6 (semaglutide) and subsequent cardiovascular outcome trials including REWIND (dulaglutide) and SELECT (semaglutide in obesity without diabetes) confirmed that GLP-1R agonism reduces cardiovascular events across multiple patient populations. The FLOW trial demonstrated kidney-disease progression benefit in T2D with chronic kidney disease. The mechanisms are probably multifactorial: improved glycemia, weight loss, blood pressure reduction, direct endothelial and anti-inflammatory actions, and favorable effects on myocardial metabolism [15][19][20].

10. The Incretin Effect and Type 2 Diabetes

The "incretin effect" refers to the greater insulin response elicited by oral glucose administration compared with an isoglycemic intravenous glucose infusion [2][3][21]. In healthy adults, oral glucose elicits approximately 50-70% more insulin secretion than matched IV glucose — the difference is attributable to nutrient-stimulated release of GLP-1 and GIP from the gut.

Nauck's seminal 1986 observation was that this incretin effect is markedly reduced in type 2 diabetes [2]. Subsequent work dissected the defect: GIP retains normal secretion but its beta-cell insulinotropic action is severely blunted in T2D and cannot be restored even with pharmacological doses [3][21]. GLP-1 secretion is modestly reduced but its insulinotropic action is largely preserved — provided that pharmacological (supraphysiological) concentrations are achieved. This asymmetry between the two incretins is the central reason why GLP-1R agonists, and not GIP agonists alone, became the dominant incretin-based therapy for T2D.

More recently, co-agonists such as tirzepatide (dual GIP/GLP-1R) have shown that when glycemia is first improved with potent GLP-1R agonism, GIPR action is partially restored — providing additive glycemic and weight-loss effects [21][23].

11. Pharmacologic Analogs and Therapeutics

Multiple classes of drug leverage GLP-1 biology [13][20][21][23][24]:

GLP-1R Agonists (DPP-4 resistant peptide analogs)

• Exenatide (Byetta, Bydureon): synthetic form of exendin-4 from Heloderma suspectum; twice-daily SC for the immediate-release form, once-weekly for the extended-release microsphere formulation
• Liraglutide (Victoza for T2D, Saxenda for obesity): acylated with palmitic acid via a gamma-glutamate linker, binds albumin non-covalently, half-life approximately 13 hours, once-daily SC
• Lixisenatide (Adlyxin/Lyxumia): modified exendin-4, once-daily SC
• Semaglutide (Ozempic, Wegovy, Rybelsus): Aib8 substitution plus C18 diacid fatty-acid side chain, half-life approximately 7 days, once-weekly SC or once-daily oral
• Dulaglutide (Trulicity): GLP-1 analog fused to a modified IgG4 Fc region, once-weekly SC

Dual and Triple Agonists

• Tirzepatide (Mounjaro, Zepbound): dual GIP/GLP-1R agonist, once-weekly SC, superior weight loss vs GLP-1-only agonists
• Retatrutide (investigational): triple GIP/GLP-1/glucagon agonist with even larger weight-loss signal in Phase 2

DPP-4 Inhibitors

Small-molecule inhibitors (sitagliptin, vildagliptin, saxagliptin, linagliptin, alogliptin) raise intact endogenous GLP-1 levels approximately 2- to 3-fold — producing modest glycemic benefit without weight loss, and with a different (milder) side-effect profile than GLP-1R agonists.

12. Physiological vs Pharmacological GLP-1

A critical conceptual point in modern GLP-1 biology is the distinction between physiological and pharmacological GLP-1 signaling [20]:

• Physiological GLP-1 — released from L-cells in response to meals, circulates at low-picomolar concentrations, has a half-life of 1-2 minutes, and exerts modest local (vagal afferent, portal vein) and systemic effects. Its main role is probably to fine-tune postprandial glycemia and contribute to meal termination.
• Pharmacological GLP-1R agonism — sustains supraphysiological receptor occupancy for hours or days, engages CNS GLP-1R far more extensively than endogenous hormone, and produces effects (15-25% body weight loss, 1.5-2.0% HbA1c reduction, MACE reduction) that endogenous GLP-1 cannot achieve.

This explains why, although GLP-1 secretion is only modestly reduced in obesity and T2D [8][20], pharmacological GLP-1R agonism produces dramatic clinical effects: the drugs are not simply replacing a missing hormone — they are exploiting the GLP-1R as a pharmacological lever far beyond its evolved physiological range.

13. Clinical Evidence Summary

14. Dosing in Research

Because native GLP-1 is not a practical therapeutic, clinical dosing has almost exclusively used the pharmacological analogs (see semaglutide, liraglutide, tirzepatide, exenatide, dulaglutide pages). The table below summarizes dosing regimens in landmark human studies of native GLP-1 itself.

15. Safety Considerations

Native GLP-1 administered in physiological to moderately supraphysiological doses in research settings is generally well tolerated. Transient nausea is dose-dependent, and hypoglycemia is rare because of the glucose-dependent insulinotropic mechanism. Longer-term safety data specific to native GLP-1 are limited, since sustained clinical use is not practical.

The safety profile of pharmacological GLP-1R agonists — gastrointestinal side effects (nausea, vomiting, diarrhea, constipation), gallbladder disease, rare acute pancreatitis, the rodent-derived boxed warning for medullary thyroid carcinoma [18], and monitoring for depression/suicidal ideation — is discussed in detail on the individual drug pages (semaglutide, liraglutide, tirzepatide).

16. Related Peptides

See also: Semaglutide, Liraglutide, Tirzepatide, Exenatide, Dulaglutide, Glucagon

17. References

1. [1] Kreymann B, Williams G, Ghatei MA, Bloom SR. (1987). Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. DOI PubMed
2. [2] Nauck M, Stockmann F, Ebert R, Creutzfeldt W. (1986). Reduced incretin effect in type 2 (non-insulin-dependent) diabetes. Diabetologia. DOI PubMed
3. [3] Nauck MA, Heimesaat MM, Orskov C, Holst JJ, Ebert R, Creutzfeldt W. (1993). Preserved incretin activity of glucagon-like peptide 1 (7-36 amide) but not of synthetic human gastric inhibitory polypeptide in patients with type-2 diabetes mellitus. Journal of Clinical Investigation. DOI PubMed
4. [4] Deacon CF, Johnsen AH, Holst JJ. (1995). Degradation of glucagon-like peptide-1 by human plasma in vitro yields an N-terminally truncated peptide that is a major endogenous metabolite in vivo. Journal of Clinical Endocrinology and Metabolism. DOI PubMed
5. [5] Scrocchi LA, Brown TJ, MaClusky N, et al. (1996). Glucose intolerance but normal satiety in mice with a null mutation in the glucagon-like peptide 1 receptor gene. Nature Medicine. DOI PubMed
6. [6] Turton MD, O'Shea D, Gunn I, et al. (1996). A role for glucagon-like peptide-1 in the central regulation of feeding. Nature. DOI PubMed
7. [7] Flint A, Raben A, Astrup A, Holst JJ. (1998). Glucagon-like peptide 1 promotes satiety and suppresses energy intake in humans. Journal of Clinical Investigation. DOI PubMed
8. [8] Ranganath LR, Beety JM, Morgan LM, Wright JW, Howland R, Marks V. (1996). Attenuated GLP-1 secretion in obesity: cause or consequence?. Gut. DOI PubMed
9. [9] Zander M, Madsbad S, Madsen JL, Holst JJ. (2002). Effect of 6-week course of glucagon-like peptide 1 on glycaemic control, insulin sensitivity, and beta-cell function in type 2 diabetes: a parallel-group study. Lancet. DOI PubMed
10. [10] Holst JJ. (2007). The physiology of glucagon-like peptide 1. Physiological Reviews. DOI PubMed
11. [11] Zhang Y, Sun B, Feng D, et al. (2017). Cryo-EM structure of the activated GLP-1 receptor in complex with a G protein. Nature. DOI PubMed
12. [12] Muller TD, Finan B, Bloom SR, et al. (2019). Glucagon-like peptide 1 (GLP-1). Molecular Metabolism. DOI PubMed
13. [13] Drucker DJ. (2018). Mechanisms of Action and Therapeutic Application of Glucagon-like Peptide-1. Cell Metabolism. DOI PubMed
14. [14] MacDonald PE, El-Kholy W, Riedel MJ, Salapatek AM, Light PE, Wheeler MB. (2002). GLP-1 receptor activated insulin secretion from pancreatic beta-cells: mechanism and glucose dependence. Diabetes, Obesity and Metabolism. DOI PubMed
15. [15] Drucker DJ. (2016). The Cardiovascular Biology of Glucagon-like Peptide-1. Cell Metabolism. DOI PubMed
16. [16] Ugleholdt R, Zhu X, Deacon CF, Orskov C, Steiner DF, Holst JJ. (2001). Coregulation of glucagon-like peptide-1 synthesis with proglucagon and prohormone convertase 1 gene expression in enteroendocrine GLUTag cells. Endocrinology. DOI PubMed
17. [17] Ritzel R, Orskov C, Holst JJ, Nauck MA. (1995). Pharmacokinetic, insulinotropic, and glucagonostatic properties of GLP-1 (7-36 amide) after subcutaneous injection in healthy volunteers. Dose-response relationships. Diabetologia. DOI PubMed
18. [18] Bjerre Knudsen L, Madsen LW, Andersen S, et al. (2010). Glucagon-like peptide-1 receptor agonists activate rodent thyroid C-cells causing calcitonin release and C-cell proliferation. Endocrinology. DOI PubMed
19. [19] Marso SP, Daniels GH, Brown-Frandsen K, et al. (2016). Liraglutide and Cardiovascular Outcomes in Type 2 Diabetes (LEADER). New England Journal of Medicine. DOI PubMed
20. [20] Drucker DJ, Holst JJ. (2024). GLP-1 physiology in obesity and development of incretin-based drugs for chronic weight management. Nature Metabolism. DOI PubMed
21. [21] Nauck MA, Meier JJ. (2021). The evolving story of incretins (GIP and GLP-1) in metabolic and cardiovascular disease: A pathophysiological update. Diabetes, Obesity and Metabolism. DOI PubMed
22. [22] Deacon CF. (2004). Circulation and degradation of GIP and GLP-1. Hormone and Metabolic Research. DOI PubMed
23. [23] Muller TD, Bluher M, Tschop MH, DiMarchi RD. (2022). Anti-obesity drug discovery: advances and challenges. Nature Reviews Drug Discovery. DOI PubMed
24. [24] Knudsen LB, Lau J. (2019). The Discovery and Development of Liraglutide and Semaglutide. Frontiers in Endocrinology. DOI PubMed
25. [25] Baggio LL, Drucker DJ. (2007). Biology of incretins: GLP-1 and GIP. Gastroenterology. DOI PubMed